Talk:Enaptin

From Wikipedia, the free encyclopedia

Molecular and Cellular Biology WikiProject
MCB Portal
This article is within the scope of the Molecular and Cellular Biology WikiProject. To participate, visit the WikiProject for more information. The WikiProject's current monthly collaboration is focused on improving Restriction enzyme.
Start This article has been rated as start-Class on the assessment scale.
Low This article is on a subject of low-importance within molecular and cellular biology.

Article Grading: The article has been rated for quality and/or importance but has no comments yet. If appropriate, please review the article and then leave comments here to identify the strengths and weaknesses of the article and what work it will need.

wow

  • Could anyone explain why the word is so long?
  • It is not a word per se, but rather a chemical code, as with other similiar substances.

Contents

[edit] Look at the crap!

What was with all this:

MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-

(times eight)

? --User:Alex12_3

  • Are you an idiot? Did you even try reading the article? -- BRIAN0918  03:22, 30 Mar 2005 (UTC)
  • Yeah, I didn't understand it either at first...... then I read the article --Headcase 05:09, 30 Mar 2005 (UTC)

[edit] Not the longest

It's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918  05:28, 30 Mar 2005 (UTC)

  • Alright, it's official: 189,819 letters. -- BRIAN0918  05:43, 30 Mar 2005 (UTC)

[edit] Article be cleaned up please

Article be cleaned up please secfan 08:31, Mar 30, 2005 (UTC)

[edit] Removing that long word...

I suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. secfan 11:08, Mar 30, 2005 (UTC)

In contrast to Titin, there are little web pages containing the full chemical name of Enaptin. Therefore, I would like to ask everybody for giving reliable web pages about it, except the following web pages:

I provide the preceding web pages for somebody who has curiosity. QQ (talk) 20:34, 17 February 2008 (UTC)

[edit] Thanks for the vandalism

Thanks for completely vandalizing and tearing to shreds my article overnight. Did any of you even bother to correct the vandalism in the page? No. You were too busy deleting all of its contents to notice the vandalism. -- BRIAN0918  12:58, 30 Mar 2005 (UTC)

[edit] How pitiful...

Just because the f***ing molecule's name is so long you are having a fight? Come to your senses! --Belgrader 17:59, 30 Mar 2005 (UTC)