Wikipedia:Deletion log archive/October 2002
From Wikipedia, the free encyclopedia
- 22:08 Oct 31, 2002 Maveric149 deleted "Computer keyboard"
- 20:47 Oct 31, 2002 Tarquin deleted "Solar tower"
- 15:55 Oct 31, 2002 Jheijmans deleted "Modern Pentathlon at the 1936 Summer Olympics"
- 09:43 Oct 31, 2002 Magnus Manske deleted "Saint-Cyr"
- 08:46 Oct 31, 2002 Magnus Manske deleted "Data storage"
- 08:11 Oct 31, 2002 Jheijmans deleted "Liar (short story)"
- 08:11 Oct 31, 2002 Jheijmans deleted "Sumerian Early Dynastic period"
- 08:10 Oct 31, 2002 Jheijmans deleted "Analog first generation"
- 08:10 Oct 31, 2002 Jheijmans deleted "Automaton"
- 08:10 Oct 31, 2002 Jheijmans deleted "State diagram"
- 08:10 Oct 31, 2002 Jheijmans deleted "Talk:2209"
- 08:10 Oct 31, 2002 Jheijmans deleted "2209"
- 08:09 Oct 31, 2002 Jheijmans deleted "Turing reduction"
- 08:09 Oct 31, 2002 Jheijmans deleted "Kitakyushu"
- 08:08 Oct 31, 2002 Jheijmans deleted "Fraser River"
- 08:08 Oct 31, 2002 Jheijmans deleted "La Cliqua"
- 08:07 Oct 31, 2002 Jheijmans deleted "Ad hoc protocol list"
- 07:37 Oct 31, 2002 JeLuF deleted "Sir Andrew Ramsay"
- 07:37 Oct 31, 2002 JeLuF deleted "Synonymy"
- 06:48 Oct 31, 2002 Sjc deleted "Peter Tosh"
- 05:32 Oct 31, 2002 Brion VIBBER deleted "Christian Dior"
- 05:22 Oct 31, 2002 Maveric149 deleted "Rhenium/Temp"
- 03:36 Oct 31, 2002 PierreAbbat deleted "Richard Leakey"
- 23:58 Oct 30, 2002 PierreAbbat deleted "Charles's law"
- 22:55 Oct 30, 2002 The Epopt deleted "Agosta 90B class submarine"
- 20:36 Oct 30, 2002 JeLuF deleted "Olde Cheshire Cheese (London pub)"
- 20:35 Oct 30, 2002 JeLuF deleted "Top-down"
- 20:34 Oct 30, 2002 JeLuF deleted "Nearest neighbor algorithm"
- 20:33 Oct 30, 2002 JeLuF deleted "Dog whistle"
- 20:32 Oct 30, 2002 JeLuF deleted "Sforzando"
- 18:57 Oct 30, 2002 Tarquin deleted "BLT sandwitch"
- 18:56 Oct 30, 2002 Tarquin deleted "BLT sandwich"
- 18:54 Oct 30, 2002 Tarquin deleted "Club sandwich"
- 15:51 Oct 30, 2002 Tarquin deleted "N'Djamena"
- 15:50 Oct 30, 2002 Ed Poor deleted "Renaming page, as suggested"
- 15:46 Oct 30, 2002 Tarquin deleted "WikiWiki)"
- 15:37 Oct 30, 2002 Magnus Manske deleted "WikiWiki)"
- 12:52 Oct 30, 2002 Brion VIBBER deleted "CMOS Memory"
- 12:14 Oct 30, 2002 Tarquin deleted "Nipple piercing"
- 10:50 Oct 30, 2002 Jheijmans deleted "De Witt Clinton"
- 10:50 Oct 30, 2002 Jheijmans deleted "Preda Mihailescu"
- 10:50 Oct 30, 2002 Jheijmans deleted "When it Happens"
- 10:49 Oct 30, 2002 Jheijmans deleted "Mossel Bay"
- 04:32 Oct 30, 2002 Brion VIBBER deleted "Zu Chen"
- 04:32 Oct 30, 2002 Brion VIBBER deleted "Jun Xie"
- 01:28 Oct 30, 2002 PierreAbbat deleted "Henri D�sir� Landru"
- 23:10 Oct 29, 2002 Brion VIBBER deleted "Mercury-in-glass thermometer"
- 23:01 Oct 29, 2002 PierreAbbat deleted "Thylakoid"
- 22:54 Oct 29, 2002 PierreAbbat deleted "Image:Vaag.JPG"
- 21:26 Oct 29, 2002 Jheijmans deleted "Edit"
- 21:26 Oct 29, 2002 Jheijmans deleted "Tramping"
- 20:20 Oct 29, 2002 JeLuF deleted "Lloyd Bentsen"
- 19:21 Oct 29, 2002 Tarquin deleted "Harry Potter and the Order of the Phoenix"
- 17:32 Oct 29, 2002 Ed Poor deleted "Moscow theatre siege"
- 13:59 Oct 29, 2002 Brion VIBBER deleted "Hitler: The Last Ten Days"
- 13:52 Oct 29, 2002 Brion VIBBER deleted "Battle of Otford"
- 13:31 Oct 29, 2002 Brion VIBBER deleted "Talk:Hafez al-Assad"
- 13:30 Oct 29, 2002 Brion VIBBER deleted "Image talk:Hitler.jpg"
- 13:27 Oct 29, 2002 Brion VIBBER deleted "Sukarno"
- 13:26 Oct 29, 2002 Brion VIBBER deleted "Suharto"
- 11:26 Oct 29, 2002 Karen Johnson deleted "X/Open"
- 10:00 Oct 29, 2002 Karen Johnson deleted "Peasant rebellion"
- 09:53 Oct 29, 2002 Karen Johnson deleted "University of Birmingham"
- 09:51 Oct 29, 2002 Karen Johnson deleted "Dictionary of the Norwegian Dialects"
- 09:14 Oct 29, 2002 Brion VIBBER deleted "St. Paul's Cathedral"
- 07:52 Oct 29, 2002 Jheijmans deleted "Bob Kane"
- 07:13 Oct 29, 2002 JeLuF deleted "Pi-calculus"
- 07:13 Oct 29, 2002 JeLuF deleted "Dwarf elliptical galaxy"
- 05:23 Oct 29, 2002 AxelBoldt deleted "Post system"
- 04:21 Oct 29, 2002 Koyaanis Qatsi deleted "Image:Aalayout.jpg"
- 03:27 Oct 29, 2002 PierreAbbat deleted "0001 B.C."
- 03:24 Oct 29, 2002 PierreAbbat deleted "Talk:Hydroelectricity"
- 03:23 Oct 29, 2002 PierreAbbat deleted "Archaism"
- 03:09 Oct 29, 2002 Karen Johnson deleted "Image:Marigoldthumbnail.pg.jpg"
- 03:07 Oct 29, 2002 Karen Johnson deleted "Mechanical energy"
- 03:06 Oct 29, 2002 Karen Johnson deleted "Breach of contract"
- 03:06 Oct 29, 2002 Karen Johnson deleted "Isolating language"
- 03:05 Oct 29, 2002 Karen Johnson deleted "Gush Shalom"
- 03:05 Oct 29, 2002 Karen Johnson deleted "Push-down automaton"
- 03:04 Oct 29, 2002 Karen Johnson deleted "Morrill act"
- 01:03 Oct 29, 2002 Tarquin deleted "OMW"
- 19:43 Oct 28, 2002 JeLuF deleted "Free Software movement"
- 18:23 Oct 28, 2002 Jheijmans deleted "Fabio"
- 18:22 Oct 28, 2002 Jheijmans deleted "Application server"
- 15:56 Oct 28, 2002 Ed Poor deleted "Unification Church and anti-Semitism"
- 15:49 Oct 28, 2002 Tarquin deleted "Cut in"
- 14:12 Oct 28, 2002 Jheijmans deleted "Rembrandt"
- 12:51 Oct 28, 2002 Magnus Manske deleted "Asian crisis"
- 08:10 Oct 28, 2002 Maveric149 deleted "Nonviolence"
- 07:53 Oct 28, 2002 Jheijmans deleted "Andorra la Vella"
- 06:51 Oct 28, 2002 Karen Johnson deleted "Mitochondrial membrane"
- 06:40 Oct 28, 2002 Karen Johnson deleted "Michigan Rummy"
- 06:10 Oct 28, 2002 Karen Johnson deleted "The war against Reform and Conservative Judaism"
- 06:03 Oct 28, 2002 Koyaanis Qatsi deleted "David Matthews"
- 05:50 Oct 28, 2002 Karen Johnson deleted "Demagoguery"
- 05:47 Oct 28, 2002 Karen Johnson deleted "Motor coil resistance"
- 05:40 Oct 28, 2002 Karen Johnson deleted "Hollywood Babylon"
- 05:40 Oct 28, 2002 Karen Johnson deleted "Tax evasion"
- 05:39 Oct 28, 2002 PierreAbbat deleted "Progenote"
- 05:39 Oct 28, 2002 Karen Johnson deleted "Progenote"
- 05:38 Oct 28, 2002 Karen Johnson deleted "Tollund"
- 05:37 Oct 28, 2002 Karen Johnson deleted "Meet in the middle"
- 05:26 Oct 28, 2002 PierreAbbat deleted "Lock and key"
- 02:53 Oct 28, 2002 Maveric149 deleted "Spindle"
- 02:24 Oct 28, 2002 Karen Johnson deleted "Talk:Mystery"
- 01:13 Oct 28, 2002 Isis deleted "Image:Tartan.PNG"
- 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg"
- 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg"
- 22:58 Oct 27, 2002 PierreAbbat deleted "Colouring algorithm"
- 22:04 Oct 27, 2002 Jheijmans deleted "Frederick II of Naples"
- 21:10 Oct 27, 2002 Jheijmans deleted "Shopping mall"
- 20:20 Oct 27, 2002 Scipius deleted "Estonia/Temp"
- 19:45 Oct 27, 2002 JeLuF deleted "Black widow spider"
- 19:37 Oct 27, 2002 Maveric149 deleted "Fort Garry"
- 17:17 Oct 27, 2002 JeLuF deleted "Fluorescent light"
- 17:15 Oct 27, 2002 JeLuF deleted "Rollie Fingers"
- 17:13 Oct 27, 2002 JeLuF deleted "Dogrib"
- 17:06 Oct 27, 2002 JeLuF deleted "Page Widening"
- 14:28 Oct 27, 2002 Magnus Manske deleted "Image:Soldierwithwings thumb.htm"
- 12:31 Oct 27, 2002 Jheijmans deleted "User:Jheijmans/Zandbak"
- 12:03 Oct 27, 2002 Jheijmans deleted "Quantum dot computer"
- 12:02 Oct 27, 2002 Jheijmans deleted "Joel David Bondurant"
- 12:01 Oct 27, 2002 Jheijmans deleted "Kassubian"
- 08:34 Oct 27, 2002 JeLuF deleted "Goddess of Democracy"
- 07:41 Oct 27, 2002 Maveric149 deleted "John Wilkins"
- 03:13 Oct 27, 2002 Brion VIBBER deleted "Basidium"
- 03:09 Oct 27, 2002 Brion VIBBER deleted "Espionage Act"
- 02:34 Oct 27, 2002 PierreAbbat deleted "Eurpoean"
- 01:10 Oct 27, 2002 PierreAbbat deleted "Talk:Francesco Andreini"
- 22:04 Oct 26, 2002 Maveric149 deleted "User:194.117.133.196"
- 21:58 Oct 26, 2002 Maveric149 deleted "Hilary rosen"
- 21:57 Oct 26, 2002 Maveric149 deleted "Excrement"
- 21:57 Oct 26, 2002 Maveric149 deleted "Contructophobia"
- 21:56 Oct 26, 2002 Maveric149 deleted "0o0o0o0o0o0o0o0o0o0"
- 21:55 Oct 26, 2002 Maveric149 deleted "WikiWikiWikiWiki"
- 21:05 Oct 26, 2002 Maveric149 deleted "Greek Orthodox"
- 20:01 Oct 26, 2002 Danny deleted "Hormizd II of Persai"
- 18:56 Oct 26, 2002 Scipius deleted "Jules Bonnot"
- 15:17 Oct 26, 2002 Jheijmans deleted "Zacharias Janssen"
- 15:16 Oct 26, 2002 Jheijmans deleted "Krankenhaus"
- 15:15 Oct 26, 2002 Jheijmans deleted "Mayan hieroglyph"
- 15:15 Oct 26, 2002 Jheijmans deleted "MIPS architecture/Instructions"
- 15:14 Oct 26, 2002 Jheijmans deleted "PC-DOS"
- 14:15 Oct 26, 2002 Jheijmans deleted "China/Temp"
- 12:52 Oct 26, 2002 Jheijmans deleted "Ancient Roman eschatology"
- 12:52 Oct 26, 2002 Jheijmans deleted "Albert Luthuli"
- 12:09 Oct 26, 2002 JeLuF deleted "Matabele"
- 07:18 Oct 26, 2002 JeLuF deleted "Mars bar"
- 07:17 Oct 26, 2002 JeLuF deleted "IEEE 802.10"
- 05:18 Oct 26, 2002 The Cunctator deleted "Image:Paul Wellstone.jpg"
- 22:41 Oct 25, 2002 Ed Poor deleted "Talk:Ded reckoning"
- 22:09 Oct 25, 2002 JeLuF deleted "Mo Vaughn"
- 22:08 Oct 25, 2002 JeLuF deleted "Wally Joyner"
- 21:03 Oct 25, 2002 JeLuF deleted "Mark Shuttleworth"
- 21:00 Oct 25, 2002 JeLuF deleted "Portal circulation"
- 20:51 Oct 25, 2002 JeLuF deleted "Random number generator"
- 20:13 Oct 25, 2002 Tarquin deleted "Babylonian numerals"
- 19:16 Oct 25, 2002 Sjc deleted "User:193.251.9.132 is back for more"
- 19:15 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg"
- 19:15 Oct 25, 2002 Sjc deleted "Image:Hello.jpg"
- 19:12 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Widening"
- 19:01 Oct 25, 2002 Koyaanis Qatsi deleted "Wikipedia:Ram-man"
- 18:49 Oct 25, 2002 Sjc deleted [redacted]
- 18:43 Oct 25, 2002 Koyaanis Qatsi deleted [redacted]
- 18:29 Oct 25, 2002 Jheijmans deleted "Path integral"
- 18:29 Oct 25, 2002 Jheijmans deleted "Statistical distribution"
- 18:28 Oct 25, 2002 Jheijmans deleted "Precious metal"
- 18:26 Oct 25, 2002 Jheijmans deleted "Joel David Bondurant"
- 18:26 Oct 25, 2002 Jheijmans deleted "Buffalo Bill"
- 18:26 Oct 25, 2002 Jheijmans deleted "Phylogenetic tree"
- 18:26 Oct 25, 2002 Jheijmans deleted "Residue"
- 18:25 Oct 25, 2002 Jheijmans deleted "Distance-vector routing protocol"
- 18:25 Oct 25, 2002 Jheijmans deleted "Concordance"
- 18:22 Oct 25, 2002 Jheijmans deleted "Cross-country running"
- 18:21 Oct 25, 2002 Jheijmans deleted "Royal Tombs of Ur"
- 18:21 Oct 25, 2002 Jheijmans deleted "Pictograph"
- 18:21 Oct 25, 2002 Jheijmans deleted "Allotheria"
- 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation"
- 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation"
- 18:20 Oct 25, 2002 Jheijmans deleted "Cape Fear"
- 18:20 Oct 25, 2002 Jheijmans deleted "Pierre Sauvignon de Brazza"
- 15:50 Oct 25, 2002 Andre Engels deleted "Sulfide"
- 15:48 Oct 25, 2002 Andre Engels deleted "Cupper sulfide"
- 09:35 Oct 25, 2002 Magnus Manske deleted "Markov algorithm"
- 08:47 Oct 25, 2002 Karen Johnson deleted "Mahmud I"
- 00:27 Oct 25, 2002 Koyaanis Qatsi deleted "Locro"
- 00:26 Oct 25, 2002 Koyaanis Qatsi deleted "Marching music"
- 21:18 Oct 24, 2002 JeLuF deleted "On-Line Medical Dictionary"
- 21:17 Oct 24, 2002 JeLuF deleted "Bureau of Standards"
- 21:16 Oct 24, 2002 JeLuF deleted "Frozen Four"
- 21:15 Oct 24, 2002 JeLuF deleted "The Fall of the House of Usher"
- 21:13 Oct 24, 2002 JeLuF deleted "Minbar"
- 21:13 Oct 24, 2002 JeLuF deleted "John Purroy Mitchel"
- 21:12 Oct 24, 2002 JeLuF deleted "FFS"
- 18:50 Oct 24, 2002 The Cunctator deleted "Talk:Beltway Sniper"
- 18:49 Oct 24, 2002 The Cunctator deleted "Beltway Sniper"
- 17:26 Oct 24, 2002 Ed Poor deleted "Keep on trollin trollin trollin"
- 17:23 Oct 24, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg"
- 14:08 Oct 24, 2002 Jheijmans deleted "Sunne"
- 13:42 Oct 24, 2002 Jheijmans deleted "-lvsbyn"
- 13:14 Oct 24, 2002 Jheijmans deleted "Berg"
- 08:01 Oct 24, 2002 Koyaanis Qatsi deleted "THX 1138:4EB"
- 07:42 Oct 24, 2002 Jheijmans deleted "Rustler's knot"
- 07:41 Oct 24, 2002 Jheijmans deleted "Duotrigintillion"
- 07:41 Oct 24, 2002 Jheijmans deleted "Mudhoney"
- 07:40 Oct 24, 2002 Jheijmans deleted "Geheimfernschreiber"
- 07:40 Oct 24, 2002 Jheijmans deleted "Projection"
- 07:40 Oct 24, 2002 Jheijmans deleted "Channel 5/UK"
- 06:54 Oct 24, 2002 Brion VIBBER deleted "Simon peters"
- 04:07 Oct 24, 2002 Brion VIBBER deleted "Waring's problem"
- 03:08 Oct 24, 2002 Brion VIBBER deleted "Propaganda/Slogans"
- 00:02 Oct 24, 2002 Lee Daniel Crocker deleted "Fred Olsen"
- 00:00 Oct 24, 2002 Lee Daniel Crocker deleted "James Rosenquist"
- 23:22 Oct 23, 2002 Lee Daniel Crocker deleted "Minoan civilization"
- 22:26 Oct 23, 2002 Brion VIBBER deleted "Logging file system"
- 21:08 Oct 23, 2002 Brion VIBBER deleted "Bloomingberg, ohio"
- 20:44 Oct 23, 2002 Brion VIBBER deleted "Wikipedia:VANDALISMS IN PROGRESS"
- 20:34 Oct 23, 2002 JeLuF deleted "Gonville Hall, Cambridge"
- 20:33 Oct 23, 2002 Maveric149 deleted "Spelling"
- 20:33 Oct 23, 2002 JeLuF deleted "Morton's Fork"
- 20:32 Oct 23, 2002 JeLuF deleted "User:0"
- 20:29 Oct 23, 2002 Ed Poor deleted "The weather in London"
- 20:21 Oct 23, 2002 JeLuF deleted "Wikipedia:Sucks"
- 20:20 Oct 23, 2002 Ed Poor deleted "Wikipedia:Sucks"
- 18:27 Oct 23, 2002 Maveric149 deleted "Pyramid of Djoser"
- 17:43 Oct 23, 2002 Stephen Gilbert deleted "Compound microscope"
- 17:23 Oct 23, 2002 Stephen Gilbert deleted "Tillibody"
- 17:22 Oct 23, 2002 Stephen Gilbert deleted "Tagmemics"
- 09:59 Oct 23, 2002 Andre Engels deleted "John Fahey"
- 08:10 Oct 23, 2002 Jheijmans deleted "Pet Sounds"
- 08:10 Oct 23, 2002 Jheijmans deleted "Vince Clarke"
- 08:10 Oct 23, 2002 Jheijmans deleted "Charles Augustin de Coulumb"
- 08:09 Oct 23, 2002 Jheijmans deleted "Chuck Norris"
- 01:23 Oct 23, 2002 Brion VIBBER deleted "Beltway Sniper"
- 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Delete"
- 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Dqwe"
- 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete3432432"
- 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete123"
- 00:52 Oct 23, 2002 Karen Johnson deleted "Cock"
- 00:50 Oct 23, 2002 Karen Johnson deleted "Hillel Slovak"
- 00:49 Oct 23, 2002 Karen Johnson deleted "Surf Punks"
- 00:48 Oct 23, 2002 Karen Johnson deleted "Bass rap"
- 00:47 Oct 23, 2002 Karen Johnson deleted "Sir Andrew Ramsay"
- 00:45 Oct 23, 2002 Karen Johnson deleted "Sali Berisha"
- 00:42 Oct 23, 2002 Karen Johnson deleted "Petronius"
- 00:07 Oct 23, 2002 Andre Engels deleted "Spiral galaxy"
- 00:06 Oct 23, 2002 Andre Engels deleted "Cervidae"
- 00:05 Oct 23, 2002 Andre Engels deleted "Swiss Market"
- 00:03 Oct 23, 2002 Andre Engels deleted "William Rushton"
- 19:47 Oct 22, 2002 Tarquin deleted "Lalalalalala"
- 19:26 Oct 22, 2002 Andre Engels deleted "Red River (of the South)"
- 18:17 Oct 22, 2002 Isis deleted "Image:Janegrey.jpg"
- 13:14 Oct 22, 2002 Isis deleted "Matrix(Mathematics)"
- 08:38 Oct 22, 2002 PierreAbbat deleted "Grauspitze"
- 08:07 Oct 22, 2002 Jheijmans deleted "James Richard Cross"
- 08:06 Oct 22, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction"
- 08:06 Oct 22, 2002 Jheijmans deleted "2196"
- 08:06 Oct 22, 2002 Jheijmans deleted "Hegemon"
- 08:06 Oct 22, 2002 Jheijmans deleted "Knuths up-arrow notation"
- 08:05 Oct 22, 2002 Jheijmans deleted "Sparks, Nevada"
- 08:04 Oct 22, 2002 Jheijmans deleted "Talk:OMW"
- 08:03 Oct 22, 2002 Jheijmans deleted "OMW"
- 05:39 Oct 22, 2002 Maveric149 deleted "Dispatcher"
- 05:07 Oct 22, 2002 Maveric149 deleted "Munich"
- 04:47 Oct 22, 2002 Brion VIBBER deleted "Talk:Christopher Columbus"
- 04:42 Oct 22, 2002 Brion VIBBER deleted "Christopher Columbus"
- 03:25 Oct 22, 2002 Karen Johnson deleted "Gerdy The Dinosaur"
- 00:16 Oct 22, 2002 PierreAbbat deleted "Hab Theory"
- 00:04 Oct 22, 2002 PierreAbbat deleted "Drez"
- 20:51 Oct 21, 2002 Tarquin deleted "Chronicle of a Death Foretold"
- 18:18 Oct 21, 2002 Jheijmans deleted "Talk:List of famous people who had sex with animals"
- 18:18 Oct 21, 2002 Jheijmans deleted "Talk:Benjamin Netanyahu On Terrorism"
- 18:17 Oct 21, 2002 Jheijmans deleted "Talk:Viral meme"
- 18:14 Oct 21, 2002 Jheijmans deleted "39/Smooth"
- 18:14 Oct 21, 2002 Jheijmans deleted "Kerplunk"
- 18:14 Oct 21, 2002 Jheijmans deleted "Alice Cooper"
- 18:14 Oct 21, 2002 Jheijmans deleted "PLATO game Spasim"
- 18:13 Oct 21, 2002 Jheijmans deleted "Hermann Koehl"
- 18:13 Oct 21, 2002 Jheijmans deleted "Hawkwind/Quark, Strangeness and Charm"
- 18:11 Oct 21, 2002 Jheijmans deleted "Alexander Girard"
- 18:09 Oct 21, 2002 Jheijmans deleted "George Nelson"
- 18:09 Oct 21, 2002 Jheijmans deleted "Ray Ozzie"
- 18:09 Oct 21, 2002 Jheijmans deleted "Herman Miller"
- 18:09 Oct 21, 2002 Jheijmans deleted "Gilbert Rohde"
- 18:09 Oct 21, 2002 Jheijmans deleted "Charles and Ray Eames"
- 18:09 Oct 21, 2002 Jheijmans deleted "Isamu Noguchi"
- 18:08 Oct 21, 2002 Jheijmans deleted "Gary Barwin"
- 18:07 Oct 21, 2002 Jheijmans deleted "El Elote"
- 18:06 Oct 21, 2002 Jheijmans deleted "Slaughterhouse Five"
- 18:06 Oct 21, 2002 Jheijmans deleted "IHTFP"
- 18:02 Oct 21, 2002 Jheijmans deleted "Anthony M. Buzzelli"
- 18:02 Oct 21, 2002 Jheijmans deleted "The weather in London"
- 18:00 Oct 21, 2002 Jheijmans deleted "East of Eden"
- 17:02 Oct 21, 2002 Jheijmans deleted "Bergen, Netherlands"
- 16:11 Oct 21, 2002 Maveric149 deleted "Munich"
- 13:06 Oct 21, 2002 Karen Johnson deleted "Motorola 68012"
- 12:03 Oct 21, 2002 Jheijmans deleted "Frederic Rzewski"
- 12:02 Oct 21, 2002 Jheijmans deleted "Platonic dialogues"
- 12:02 Oct 21, 2002 Jheijmans deleted "Larry Brown"
- 11:58 Oct 21, 2002 PierreAbbat deleted "KWOC"
- 07:02 Oct 21, 2002 Maveric149 deleted "Hybrid monolithic kernel"
- 07:02 Oct 21, 2002 Maveric149 deleted "Bus mastering"
- 05:36 Oct 21, 2002 Maveric149 deleted "Tungsten/Temp"
- 04:40 Oct 21, 2002 Maveric149 deleted "Middle German"
- 04:36 Oct 21, 2002 Maveric149 deleted "Dave Farrel"
- 02:30 Oct 21, 2002 Brion VIBBER deleted "Xu language"
- 02:22 Oct 21, 2002 Maveric149 deleted "Talk:Omagh bombing"
- 22:16 Oct 20, 2002 Jheijmans deleted "Hygroscopic"
- 22:16 Oct 20, 2002 Jheijmans deleted "Andrew Hartzell"
- 22:15 Oct 20, 2002 Jheijmans deleted "Rodney Moore"
- 22:15 Oct 20, 2002 Jheijmans deleted "Oyster"
- 22:14 Oct 20, 2002 Jheijmans deleted "Turbulence"
- 22:14 Oct 20, 2002 Jheijmans deleted "Langj�kull"
- 22:14 Oct 20, 2002 Jheijmans deleted "Hofsj�kull"
- 22:13 Oct 20, 2002 Jheijmans deleted "Vatnaj�kull"
- 22:13 Oct 20, 2002 Jheijmans deleted "Absurd"
- 22:13 Oct 20, 2002 Jheijmans deleted "Auguste Comte"
- 22:13 Oct 20, 2002 Jheijmans deleted "King Bowser Koopa"
- 22:13 Oct 20, 2002 Jheijmans deleted "Transylvanian Saxon"
- 22:12 Oct 20, 2002 Jheijmans deleted "Mercury-in-glass thermometer"
- 22:12 Oct 20, 2002 Jheijmans deleted "Top-down design"
- 22:11 Oct 20, 2002 Jheijmans deleted "Kid"
- 22:10 Oct 20, 2002 Jheijmans deleted "Nikolay Nikolaevich Semenov"
- 14:35 Oct 20, 2002 Tarquin deleted "Spatial tense"
- 13:13 Oct 20, 2002 PierreAbbat deleted "Habib Bourguiba"
- 13:12 Oct 20, 2002 PierreAbbat deleted "Talk:Laura Welch Bush"
- 13:10 Oct 20, 2002 PierreAbbat deleted "Adelbert von Chamisso"
- 13:10 Oct 20, 2002 PierreAbbat deleted "Derg"
- 07:42 Oct 20, 2002 Maveric149 deleted "Fritz Perls"
- 04:32 Oct 20, 2002 Maveric149 deleted "Tantalum/Temp"
- 02:32 Oct 20, 2002 The Epopt deleted "List of articles not about philosophy"
- 02:30 Oct 20, 2002 The Epopt deleted "Category experiment"
- 20:49 Oct 19, 2002 Jheijmans deleted "Carlow"
- 20:49 Oct 19, 2002 Jheijmans deleted "Jos� Ferrer"
- 20:49 Oct 19, 2002 Jheijmans deleted "Coal/History"
- 20:49 Oct 19, 2002 Jheijmans deleted "Turkmenistan/Human rights issues"
- 20:48 Oct 19, 2002 Jheijmans deleted "MeaningfulNess"
- 20:48 Oct 19, 2002 Jheijmans deleted "Shepherds Bush"
- 20:46 Oct 19, 2002 Jheijmans deleted "Italian Communist Party"
- 20:46 Oct 19, 2002 Jheijmans deleted "Fundamental dimensions/Comments"
- 20:46 Oct 19, 2002 Jheijmans deleted "Monaghan"
- 20:46 Oct 19, 2002 Jheijmans deleted "The Hanged Man"
- 20:46 Oct 19, 2002 Jheijmans deleted "Go proverb"
- 20:45 Oct 19, 2002 Jheijmans deleted "Mike Dill/My ideas on socital change and terrorism"
- 20:44 Oct 19, 2002 Jheijmans deleted "Cavan"
- 20:44 Oct 19, 2002 Jheijmans deleted "McMahon Act"
- 20:43 Oct 19, 2002 Jheijmans deleted "Writ of Certiorari"
- 20:43 Oct 19, 2002 Jheijmans deleted "Sanguozhi"
- 20:42 Oct 19, 2002 Jheijmans deleted "NAGPRA"
- 20:42 Oct 19, 2002 Jheijmans deleted "Ozarks"
- 20:42 Oct 19, 2002 Jheijmans deleted "James Barrie"
- 20:41 Oct 19, 2002 Jheijmans deleted "Fuller Seminary"
- 20:41 Oct 19, 2002 Jheijmans deleted "Erichtheus"
- 20:41 Oct 19, 2002 Jheijmans deleted "Human rights abuses"
- 20:40 Oct 19, 2002 Jheijmans deleted "C-47 Dakota"
- 20:39 Oct 19, 2002 Jheijmans deleted "C-47 Gooney Bird"
- 20:11 Oct 19, 2002 Jheijmans deleted "NormanWerner"
- 20:08 Oct 19, 2002 Jheijmans deleted "Propaganda/Slogans"
- 20:07 Oct 19, 2002 Jheijmans deleted "Reel-to-Reel"
- 20:01 Oct 19, 2002 Jheijmans deleted "Microdot"
- 20:00 Oct 19, 2002 Jheijmans deleted "CPM-86"
- 20:00 Oct 19, 2002 Jheijmans deleted "Talk:Millinery"
- 20:00 Oct 19, 2002 Jheijmans deleted "Millinery"
- 20:00 Oct 19, 2002 Jheijmans deleted "2205 BC"
- 19:59 Oct 19, 2002 Jheijmans deleted "Mikrophunk"
- 19:59 Oct 19, 2002 Jheijmans deleted "Gundobad"
- 19:59 Oct 19, 2002 Jheijmans deleted "Best-first search"
- 19:58 Oct 19, 2002 Jheijmans deleted "Talk:Philip III of Spain"
- 19:58 Oct 19, 2002 Jheijmans deleted "Philip III of Spain"
- 19:58 Oct 19, 2002 Jheijmans deleted "Ferdinand I, Holy Roman Emperor"
- 19:55 Oct 19, 2002 Jheijmans deleted "Jun Fan"
- 18:01 Oct 19, 2002 Maveric149 deleted "Siemens Nixdorf Informationssysteme AG"
- 17:38 Oct 19, 2002 Maveric149 deleted "Liaotung Peninsula"
- 16:29 Oct 19, 2002 PierreAbbat deleted "Image:Test.phtml"
- 16:25 Oct 19, 2002 PierreAbbat deleted "Image:Test.php"
- 16:17 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1edit.txt"
- 16:15 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1.txt"
- 13:35 Oct 19, 2002 Koyaanis Qatsi deleted "Image:Djmangoo-themelody.ogg"
- 13:34 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile1.gif"
- 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif"
- 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif"
- 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1.txt"
- 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1edit.txt"
- 09:52 Oct 19, 2002 Karen Johnson deleted "Bobby Bonds"
- 09:49 Oct 19, 2002 Karen Johnson deleted "Euramerica"
- 09:48 Oct 19, 2002 Karen Johnson deleted "Hermeneutic"
- 09:13 Oct 19, 2002 Karen Johnson deleted "Microsoft SQL server"
- 08:54 Oct 19, 2002 Karen Johnson deleted "Maynard James Keenan"
- 08:27 Oct 19, 2002 Karen Johnson deleted "Macuxi"
- 08:25 Oct 19, 2002 Karen Johnson deleted "Padborg"
- 04:48 Oct 19, 2002 Koyaanis Qatsi deleted "Two Women"
- 04:46 Oct 19, 2002 Koyaanis Qatsi deleted "A page that will never be written unless some jerk writes it"
- 01:34 Oct 19, 2002 Maveric149 deleted "Hernan Cortes"
- 01:19 Oct 19, 2002 PierreAbbat deleted "Parse tree"
- 23:30 Oct 18, 2002 PierreAbbat deleted "Newbie"
- 22:19 Oct 18, 2002 Maveric149 deleted "Canadian Alliance"
- 22:05 Oct 18, 2002 Maveric149 deleted "Thirteen Years' War"
- 21:18 Oct 18, 2002 Ed Poor deleted "Univeristy of California, Berkeley"
- 20:46 Oct 18, 2002 Lee Daniel Crocker deleted "Max Stirner"
- 18:52 Oct 18, 2002 Maveric149 deleted "Hawker Hunter"
- 11:34 Oct 18, 2002 Karen Johnson deleted "Lindau"
- 11:33 Oct 18, 2002 Karen Johnson deleted "Ruma"
- 11:32 Oct 18, 2002 Karen Johnson deleted "KDD"
- 11:31 Oct 18, 2002 Karen Johnson deleted "Law of conservation of matter"
- 10:38 Oct 18, 2002 PierreAbbat deleted "Asymmetric cryptography"
- 03:43 Oct 18, 2002 PierreAbbat deleted "Battle of Eylau"
- 00:03 Oct 18, 2002 PierreAbbat deleted "My"
- 23:03 Oct 17, 2002 Andre Engels deleted "Chilomonas"
- 22:30 Oct 17, 2002 PierreAbbat deleted "2208"
- 22:28 Oct 17, 2002 PierreAbbat deleted "Water wheel"
- 22:25 Oct 17, 2002 PierreAbbat deleted "ASF"
- 18:23 Oct 17, 2002 Maveric149 deleted "Goedel's completeness theorem"
- 13:51 Oct 17, 2002 Andre Engels deleted "Soon"
- 12:34 Oct 17, 2002 Andre Engels deleted "First Crusade"
- 12:00 Oct 17, 2002 Stephen Gilbert deleted "Wardian case"
- 01:51 Oct 17, 2002 PierreAbbat deleted "Christian Dior"
- 01:49 Oct 17, 2002 PierreAbbat deleted "Hybrid monolithic kernel"
- 01:15 Oct 17, 2002 Stephen Gilbert deleted "Turn-based game"
- 01:15 Oct 17, 2002 Stephen Gilbert deleted "Alain Mimoun"
- 22:09 Oct 16, 2002 PierreAbbat deleted "Screen Actors Guild"
- 22:08 Oct 16, 2002 PierreAbbat deleted "Middle-Earth Roleplaying System"
- 19:46 Oct 16, 2002 Tarquin deleted "Conspicuous consumption"
- 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology"
- 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology"
- 15:52 Oct 16, 2002 Andre Engels deleted "Scientific mythology"
- 15:48 Oct 16, 2002 Tarquin deleted "Blue Nile"
- 15:33 Oct 16, 2002 Andre Engels deleted "Talk:Hayden Christiansen"
- 15:27 Oct 16, 2002 Andre Engels deleted "Talk:Millions of worthless articles"
- 15:22 Oct 16, 2002 Andre Engels deleted "Talk:Friends United Meeting"
- 15:10 Oct 16, 2002 Andre Engels deleted "Talk:Q Codes"
- 11:53 Oct 16, 2002 PierreAbbat deleted "Thivai"
- 11:40 Oct 16, 2002 PierreAbbat deleted "Travels With Charley"
- 11:38 Oct 16, 2002 PierreAbbat deleted "Problem domain"
- 11:22 Oct 16, 2002 Andre Engels deleted "John Forbes Nash"
- 10:43 Oct 16, 2002 Jheijmans deleted "The Oresteia"
- 10:43 Oct 16, 2002 Jheijmans deleted "Business management"
- 10:42 Oct 16, 2002 Jheijmans deleted "Ray Gillen"
- 09:35 Oct 16, 2002 Andre Engels deleted "Image:German flag 1815.png"
- 09:33 Oct 16, 2002 Andre Engels deleted "Xenon/Temp"
- 08:09 Oct 16, 2002 Sjc deleted "Amatol"
- 06:47 Oct 16, 2002 Jheijmans deleted "Akron, Ohio"
- 06:47 Oct 16, 2002 Jheijmans deleted "Penal code"
- 06:47 Oct 16, 2002 Jheijmans deleted "Superstring"
- 06:47 Oct 16, 2002 Jheijmans deleted "Unified field theory"
- 06:46 Oct 16, 2002 Jheijmans deleted "Other LZ compression methods"
- 06:46 Oct 16, 2002 Jheijmans deleted "Bizarro"
- 06:46 Oct 16, 2002 Jheijmans deleted "Ear piercing"
- 05:59 Oct 16, 2002 Sjc deleted "Flying Wedge"
- 05:57 Oct 16, 2002 Sjc deleted "AEW"
- 02:47 Oct 16, 2002 PierreAbbat deleted "Homeric Hymns"
- 02:46 Oct 16, 2002 PierreAbbat deleted "Pisistratos"
- 01:19 Oct 16, 2002 Maveric149 deleted "Sweet Home Alabama (movie)"
- 01:05 Oct 16, 2002 Maveric149 deleted "USS Valley"
- 00:14 Oct 16, 2002 PierreAbbat deleted "Jay Warren"
- 00:12 Oct 16, 2002 PierreAbbat deleted "Mustique"
- 22:56 Oct 15, 2002 Maveric149 deleted "Egg cell"
- 22:53 Oct 15, 2002 Jheijmans deleted "Ciutat Vella"
- 22:49 Oct 15, 2002 Jheijmans deleted "Like nailing jelly to a tree"
- 22:48 Oct 15, 2002 Jheijmans deleted "Like kicking dead whales down the beach"
- 22:16 Oct 15, 2002 Jheijmans deleted "James Batcheller Sumner"
- 22:16 Oct 15, 2002 Jheijmans deleted "MC Det"
- 22:06 Oct 15, 2002 Jheijmans deleted "New England boiled dinner"
- 22:06 Oct 15, 2002 Jheijmans deleted "1208 BC"
- 22:06 Oct 15, 2002 Jheijmans deleted "WikiProject Biology"
- 22:05 Oct 15, 2002 Jheijmans deleted "Abelian variety"
- 22:05 Oct 15, 2002 Jheijmans deleted "Cassette"
- 22:04 Oct 15, 2002 Jheijmans deleted "DBA"
- 22:04 Oct 15, 2002 Jheijmans deleted "Application layer"
- 22:04 Oct 15, 2002 Jheijmans deleted "Vacation"
- 22:04 Oct 15, 2002 Jheijmans deleted "Caledonia"
- 22:03 Oct 15, 2002 Jheijmans deleted "Lamp"
- 22:03 Oct 15, 2002 Jheijmans deleted "Talk:Status"
- 22:03 Oct 15, 2002 Jheijmans deleted "Status"
- 22:02 Oct 15, 2002 Jheijmans deleted "Mathematics Magazine"
- 22:02 Oct 15, 2002 Jheijmans deleted "Rangefinder cameras"
- 22:02 Oct 15, 2002 Jheijmans deleted "Copy protection"
- 22:02 Oct 15, 2002 Jheijmans deleted "Other LZ compression methods"
- 22:01 Oct 15, 2002 Maveric149 deleted "Laccolith"
- 19:37 Oct 15, 2002 Brion VIBBER deleted "Microsoft Windows 2.0"
- 18:59 Oct 15, 2002 Stephen Gilbert deleted "Talk:Put"
- 18:58 Oct 15, 2002 Stephen Gilbert deleted "SPIHT"
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "Put"
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "Marcel Petiot"
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "WSDL"
- 18:28 Oct 15, 2002 Magnus Manske deleted "L�ndervorwahlen/nachNummern"
- 18:26 Oct 15, 2002 Tarquin deleted "User:ZxAnPhOrIaN/StateReportSites"
- 18:00 Oct 15, 2002 Scipius deleted "Jean Renoir"
- 14:48 Oct 15, 2002 Tarquin deleted "Cretinous"
- 14:44 Oct 15, 2002 Tarquin deleted "Brain-damaged"
- 13:10 Oct 15, 2002 Tarquin deleted "Calculus/chain rule"
- 12:29 Oct 15, 2002 Tarquin deleted "Prime number/Talk"
- 10:16 Oct 15, 2002 Jheijmans deleted "Slovenia/Temp"
- 06:42 Oct 15, 2002 Jheijmans deleted "USS Lake"
- 06:41 Oct 15, 2002 Jheijmans deleted "USS Philippine"
- 06:41 Oct 15, 2002 Jheijmans deleted "USS Bunker"
- 06:40 Oct 15, 2002 Jheijmans deleted "USS San"
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Leyte"
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Coral"
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Belleau"
- 06:09 Oct 15, 2002 Karen Johnson deleted "USS Franklin"
- 02:02 Oct 15, 2002 Karen Johnson deleted "Brown Deer, Wisconsin"
- 02:01 Oct 15, 2002 Karen Johnson deleted "4004 BC"
- 02:01 Oct 15, 2002 Karen Johnson deleted "Jacques Cossette-Trudel"
- 02:00 Oct 15, 2002 Karen Johnson deleted "University of Wisconsin, Stout"
- 01:59 Oct 15, 2002 Karen Johnson deleted "Jangyn Bridge"
- 01:59 Oct 15, 2002 Karen Johnson deleted "Poissy"
- 01:59 Oct 15, 2002 Karen Johnson deleted "Talk:Poissy"
- 01:58 Oct 15, 2002 Karen Johnson deleted "Xerox 1108"
- 01:57 Oct 15, 2002 Karen Johnson deleted "Data vector"
- 01:55 Oct 15, 2002 Karen Johnson deleted "Danville, Kentucky"
- 22:15 Oct 14, 2002 Jheijmans deleted "Bosnian language"
- 21:57 Oct 14, 2002 Scipius deleted "Electric battery"
- 21:44 Oct 14, 2002 Scipius deleted "Talk:Germany/Temp"
- 21:43 Oct 14, 2002 Scipius deleted "Germany/Temp"
- 21:13 Oct 14, 2002 Jheijmans deleted "Erasmus"
- 21:00 Oct 14, 2002 PierreAbbat deleted "General Federation of Jewish Labour"
- 16:35 Oct 14, 2002 Jheijmans deleted "Liudolf of Swabia"
- 16:33 Oct 14, 2002 Jheijmans deleted "Quay"
- 16:30 Oct 14, 2002 Jheijmans deleted "Emma Bunton"
- 16:30 Oct 14, 2002 Jheijmans deleted "Pavel Chekov"
- 12:26 Oct 14, 2002 Brion VIBBER deleted "TWA 847 hijacking"
- 11:58 Oct 14, 2002 PierreAbbat deleted "U.S. presidential election, 2012"
- 09:31 Oct 14, 2002 Maveric149 deleted "Route inspection problem"
- 08:55 Oct 14, 2002 Maveric149 deleted "Popper"
- 07:56 Oct 14, 2002 Magnus Manske deleted "Henk Rogers"
- 07:49 Oct 14, 2002 Jheijmans deleted "Ani Yuntikwalaski"
- 07:48 Oct 14, 2002 Jheijmans deleted "Zulch, Evan"
- 07:48 Oct 14, 2002 Jheijmans deleted "Evan Zulch"
- 07:46 Oct 14, 2002 Jheijmans deleted "Sandra Dempsey"
- 07:45 Oct 14, 2002 Jheijmans deleted "Cassiodorus"
- 07:45 Oct 14, 2002 Jheijmans deleted "Daniel Vettori"
- 07:44 Oct 14, 2002 Jheijmans deleted "El Lissitzky"
- 07:44 Oct 14, 2002 Jheijmans deleted "Text to speech"
- 07:44 Oct 14, 2002 Jheijmans deleted "Natural language generation"
- 07:44 Oct 14, 2002 Jheijmans deleted "Program transformation"
- 06:27 Oct 14, 2002 Sjc deleted "Maclyn McCarty"
- 04:24 Oct 14, 2002 Maveric149 deleted "2109"
- 03:37 Oct 14, 2002 Maveric149 deleted "Phosphorus/Temp"
- 01:03 Oct 14, 2002 Maveric149 deleted "Law of Octaves"
- 00:56 Oct 14, 2002 Maveric149 deleted "Andr� Malraux"
- 22:53 Oct 13, 2002 PierreAbbat deleted "Rockefeller Institute"
- 22:52 Oct 13, 2002 PierreAbbat deleted "Acrostic puzzle"
- 22:50 Oct 13, 2002 Tarquin deleted "Raymon Smullyan"
- 21:19 Oct 13, 2002 Bryan Derksen deleted "Great Red Spot"
- 21:14 Oct 13, 2002 Maveric149 deleted "Superscript"
- 21:13 Oct 13, 2002 Maveric149 deleted "Natural order"
- 21:08 Oct 13, 2002 Andre Engels deleted "Talk:Confused Deputy Problem"
- 21:01 Oct 13, 2002 Andre Engels deleted "Talk:Common Earth Language"
- 20:58 Oct 13, 2002 Andre Engels deleted "Xerox Document Company"
- 20:58 Oct 13, 2002 Andre Engels deleted "Nuclear pile"
- 17:31 Oct 13, 2002 PierreAbbat deleted "Cheddite"
- 12:25 Oct 13, 2002 PierreAbbat deleted "Supercharger"
- 10:32 Oct 13, 2002 Sjc deleted "Holt, England"
- 10:24 Oct 13, 2002 Jheijmans deleted "Loaded terminology"
- 09:49 Oct 13, 2002 Scipius deleted "Quercus robur- Ongoing projects & To Do list..."
- 07:46 Oct 13, 2002 Sjc deleted "October 12 2002 car bomb, Kuta, Bali"
- 07:04 Oct 13, 2002 Maveric149 deleted "Latin phrases"
- 02:14 Oct 13, 2002 Maveric149 deleted "American Christian Zionists"
- 23:34 Oct 12, 2002 Scipius deleted "Curly Howard"
- 22:20 Oct 12, 2002 Jheijmans deleted "Steamboat"
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page A"
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page C"
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page B"
- 21:12 Oct 12, 2002 Tarquin deleted "Talk:The simpsons/dr. nick riviera"
- 20:37 Oct 12, 2002 Jheijmans deleted "Kent Keith"
- 20:35 Oct 12, 2002 Jheijmans deleted "FrameMaker"
- 16:35 Oct 12, 2002 Andre Engels deleted "Robert Guiscard"
- 15:59 Oct 12, 2002 Andre Engels deleted "SoHo, New York City, New York"
- 15:59 Oct 12, 2002 Andre Engels deleted "Murray Hill, New York City, New York"
- 15:58 Oct 12, 2002 Andre Engels deleted "Harlem, New York City, New York"
- 15:58 Oct 12, 2002 Andre Engels deleted "Greenwich Village, New York City, New York"
- 15:32 Oct 12, 2002 PierreAbbat deleted "List of famous people who had sex with animals"
- 14:36 Oct 12, 2002 Tarquin deleted "ZxAnPhOrIaN/StateReportSites"
- 13:09 Oct 12, 2002 PierreAbbat deleted "Charles Cunningham Boycott"
- 12:10 Oct 12, 2002 Andre Engels deleted "Internet gaming"
- 12:09 Oct 12, 2002 Andre Engels deleted "Joe Rock"
- 12:08 Oct 12, 2002 Andre Engels deleted "Herman Brusselmans"
- 12:08 Oct 12, 2002 Andre Engels deleted "Queen Anne's War"
- 11:49 Oct 12, 2002 Karen Johnson deleted "Europrix"
- 03:36 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (city names)"
- 03:35 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (ships)"
- 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (movies)"
- 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (names and titles)"
- 03:33 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (precision)"
- 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (common names)"
- 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (anglicization)"
- 03:31 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (pluralization)"
- 03:30 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (capitalization)"
- 03:28 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (acronyms)"
- 02:25 Oct 12, 2002 Karen Johnson deleted "VMWare"
- 02:24 Oct 12, 2002 Karen Johnson deleted "List of famous people who had sex with animals"
- 00:27 Oct 12, 2002 Tarquin deleted "HfTupper"
- 23:47 Oct 11, 2002 Andre Engels deleted "List of collective nouns by collective terms"
- 23:44 Oct 11, 2002 Andre Engels deleted "Talk:ColdWar"
- 23:03 Oct 11, 2002 Andre Engels deleted "Talk:Chinese characteristics"
- 22:58 Oct 11, 2002 Andre Engels deleted "Talk:Queen (Chess)"
- 22:49 Oct 11, 2002 Andre Engels deleted "Talk:Ǭ��解"
- 22:38 Oct 11, 2002 Andre Engels deleted "Talk:Candy blunt"
- 22:33 Oct 11, 2002 Andre Engels deleted "Talk:Business and Industry basic topics"
- 22:28 Oct 11, 2002 Andre Engels deleted "Talk:Bubi"
- 22:26 Oct 11, 2002 Scipius deleted "Mossel Bay"
- 22:25 Oct 11, 2002 Scipius deleted "Georges Pompidou"
- 22:24 Oct 11, 2002 Scipius deleted "Carboxyl group"
- 22:20 Oct 11, 2002 Andre Engels deleted "Talk:Bridge game"
- 22:17 Oct 11, 2002 Andre Engels deleted "Talk:Boure"
- 22:16 Oct 11, 2002 Andre Engels deleted "Talk:Boris the crazy Russian"
- 22:08 Oct 11, 2002 Andre Engels deleted "Talk:Blue-green money"
- 22:00 Oct 11, 2002 Andre Engels deleted "Talk:Bilbo"
- 21:49 Oct 11, 2002 Andre Engels deleted "Talk:Belief in God spectrum"
- 21:41 Oct 11, 2002 Andre Engels deleted "Talk:Battle of TannenburgBattle of Grunwald"
- 21:34 Oct 11, 2002 Andre Engels deleted "Talk:Baptism of the dead"
- 21:33 Oct 11, 2002 Andre Engels deleted "Talk:Bantu languages"
- 21:30 Oct 11, 2002 Andre Engels deleted "Talk:Baker Natalie Bachrach"
- 18:29 Oct 11, 2002 Ed Poor deleted "Talk:List of famous people who have pierced their private parts"
- 17:50 Oct 11, 2002 Jheijmans deleted "Victoria, Seychelles"
- 11:54 Oct 11, 2002 Andre Engels deleted "Nika revolt"
- 11:50 Oct 11, 2002 PierreAbbat deleted "Togidubnus"
- 11:15 Oct 11, 2002 Karen Johnson deleted "Antonella Brugnola"
- 07:21 Oct 11, 2002 Jheijmans deleted "Siobhan Fahey"
- 07:21 Oct 11, 2002 Jheijmans deleted "Augusta of Saxe-Gotha"
- 07:20 Oct 11, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction"
- 07:19 Oct 11, 2002 Jheijmans deleted "War of the Grand Alliance"
- 07:19 Oct 11, 2002 Jheijmans deleted "William Pitt, the Younger"
- 06:50 Oct 11, 2002 Jheijmans deleted "Partido dos Trabalhadores"
- 06:49 Oct 11, 2002 Jheijmans deleted "Amazonia"
- 06:49 Oct 11, 2002 Jheijmans deleted "Fred Olsen"
- 06:48 Oct 11, 2002 Jheijmans deleted "Talk:Autodynamics"
- 06:48 Oct 11, 2002 Jheijmans deleted "Autodynamics"
- 06:47 Oct 11, 2002 Jheijmans deleted "DNA computer"
- 06:46 Oct 11, 2002 Jheijmans deleted "Matthew Lancelot Ryan"
- 05:34 Oct 11, 2002 Maveric149 deleted "Eternity"
- 01:49 Oct 11, 2002 PierreAbbat deleted "Toba"
- 01:44 Oct 11, 2002 PierreAbbat deleted "Blah"
- 01:00 Oct 11, 2002 Maveric149 deleted "Macintosh raincoat"
- 20:49 Oct 10, 2002 Scipius deleted "Cafe wall illusion"
- 20:15 Oct 10, 2002 Tarquin deleted "Line segment"
- 20:15 Oct 10, 2002 Tarquin deleted "Pembrokeshire"
- 20:15 Oct 10, 2002 Tarquin deleted "Channel coding"
- 18:07 Oct 10, 2002 Scipius deleted "Image:Uk flag largeupsidedown.png"
- 18:04 Oct 10, 2002 Scipius deleted "Image:Waveflag.gif"
- 16:11 Oct 10, 2002 Scipius deleted "Nixon"
- 12:19 Oct 10, 2002 Jheijmans deleted "Shooting at the 1936 Summer Olympics"
- 12:08 Oct 10, 2002 Karen Johnson deleted "Shar"
- 09:28 Oct 10, 2002 Jheijmans deleted "Palette"
- 09:27 Oct 10, 2002 Jheijmans deleted "Executive department"
- 07:00 Oct 10, 2002 Maveric149 deleted "Helium/Temp"
- 06:50 Oct 10, 2002 Robert Merkel deleted "Drexel Shaft"
- 06:49 Oct 10, 2002 Robert Merkel deleted "Talk:Drexel Shaft"
- 06:46 Oct 10, 2002 Jheijmans deleted "Robert Moses"
- 06:46 Oct 10, 2002 Jheijmans deleted "Correspondence course"
- 06:44 Oct 10, 2002 Jheijmans deleted "Discordance Axis"
- 06:44 Oct 10, 2002 Jheijmans deleted "Frederick, Lord North"
- 06:44 Oct 10, 2002 Jheijmans deleted "Social Development"
- 06:43 Oct 10, 2002 Jheijmans deleted "Obfuscated PostScript Contest"
- 06:43 Oct 10, 2002 Jheijmans deleted "Gungan"
- 01:19 Oct 10, 2002 PierreAbbat deleted "Pinworm"
- 00:26 Oct 10, 2002 Andre Engels deleted "Zacharias Janssen"
- 21:43 Oct 9, 2002 PierreAbbat deleted "Motnitroat"
- 20:47 Oct 9, 2002 PierreAbbat deleted "Contract bridge palying technique"
- 19:54 Oct 9, 2002 Andre Engels deleted "Talk:50 kroner note"
- 19:54 Oct 9, 2002 Andre Engels deleted "Talk:200 kroner note"
- 19:48 Oct 9, 2002 Magnus Manske deleted "Topory"
- 19:42 Oct 9, 2002 Andre Engels deleted "Talk:ATI"
- 19:28 Oct 9, 2002 Ed Poor deleted "Time base"
- 19:27 Oct 9, 2002 Ed Poor deleted "Staff system"
- 19:27 Oct 9, 2002 Andre Engels deleted "Talk:Anthocyanins"
- 19:26 Oct 9, 2002 Andre Engels deleted "Talk:Anomy"
- 19:25 Oct 9, 2002 Andre Engels deleted "Talk:Angel/far-fetched belief"
- 19:24 Oct 9, 2002 Andre Engels deleted "Talk:Ancient civilization"
- 19:22 Oct 9, 2002 Andre Engels deleted "Talk:Anarchy Online"
- 19:20 Oct 9, 2002 Andre Engels deleted "Talk:American Union of Men"
- 19:18 Oct 9, 2002 Andre Engels deleted "Talk:Amead"
- 19:15 Oct 9, 2002 Andre Engels deleted "Talk:A.L.I.C.E"
- 18:57 Oct 9, 2002 Andre Engels deleted "Talk:Adek336"
- 18:50 Oct 9, 2002 Andre Engels deleted "Talk:2002 State of the Union Address"
- 18:49 Oct 9, 2002 Andre Engels deleted "Talk:72 virgins"
- 18:43 Oct 9, 2002 Andre Engels deleted "Talk:23nd century"
- 18:39 Oct 9, 2002 Andre Engels deleted "Talk:Antiwikipedic"
- 18:33 Oct 9, 2002 Andre Engels deleted "Painting techniques"
- 18:32 Oct 9, 2002 Andre Engels deleted "Anna Moffo"
- 17:49 Oct 9, 2002 Scipius deleted "Afar language"
- 17:44 Oct 9, 2002 Scipius deleted "Bayer Company"
- 17:39 Oct 9, 2002 Scipius deleted "Ypres"
- 17:24 Oct 9, 2002 PierreAbbat deleted "Heian Period"
- 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu"
- 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu"
- 08:09 Oct 9, 2002 Andre Engels deleted "Cleisthenes"
- 06:34 Oct 9, 2002 Jheijmans deleted "Mossel Bay"
- 06:34 Oct 9, 2002 Jheijmans deleted "Clerks"
- 06:34 Oct 9, 2002 Jheijmans deleted "World War II/The Blitz"
- 06:33 Oct 9, 2002 Jheijmans deleted "Bridge of Sighs"
- 06:32 Oct 9, 2002 Maveric149 deleted "Syntax analysis"
- 06:07 Oct 9, 2002 Maveric149 deleted "Neon/Temp"
- 00:44 Oct 9, 2002 Maveric149 deleted "Waxhaw, South Carolina"
- 22:31 Oct 8, 2002 Lee Daniel Crocker deleted "Natural catastrophe"
- 22:30 Oct 8, 2002 Lee Daniel Crocker deleted "Ignatius Donnelly"
- 21:37 Oct 8, 2002 Jheijmans deleted "Khamis Mushait"
- 21:35 Oct 8, 2002 Jheijmans deleted "Kleene algebra"
- 21:35 Oct 8, 2002 Jheijmans deleted "Extranet"
- 21:35 Oct 8, 2002 Jheijmans deleted "Young Turks"
- 21:35 Oct 8, 2002 Jheijmans deleted "Motorola 68008"
- 21:34 Oct 8, 2002 Jheijmans deleted "Milwaukee Deep"
- 21:34 Oct 8, 2002 Jheijmans deleted "Polish-Lithuanian Commonwealth"
- 19:17 Oct 8, 2002 Tarquin deleted "Clifford E. Berry"
- 17:30 Oct 8, 2002 PierreAbbat deleted "Cockermouth"
- 15:45 Oct 8, 2002 Tarquin deleted "Hiawatha"
- 15:44 Oct 8, 2002 Tarquin deleted "Mazurka"
- 10:46 Oct 8, 2002 Jheijmans deleted "Provisional Government"
- 10:37 Oct 8, 2002 Andre Engels deleted "Internet humor/Two Cows Talk"
- 10:36 Oct 8, 2002 Jheijmans deleted "Romania/Temp"
- 10:34 Oct 8, 2002 Andre Engels deleted "Beloit College"
- 10:31 Oct 8, 2002 Andre Engels deleted "New York City, New York/Murray Hill"
- 10:30 Oct 8, 2002 Andre Engels deleted "New York City, New York/Harlem"
- 08:56 Oct 8, 2002 WojPob deleted "Motorola Coldfire"
- 08:33 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with W"
- 08:32 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with X"
- 08:31 Oct 8, 2002 Jheijmans deleted "Sympathomimetic"
- 08:28 Oct 8, 2002 Jheijmans deleted "Talk:OsmosisTwo"
- 08:28 Oct 8, 2002 Jheijmans deleted "OsmosisTwo"
- 08:27 Oct 8, 2002 Jheijmans deleted "Protea"
- 08:26 Oct 8, 2002 Jheijmans deleted "Teunis de Wit"
- 08:26 Oct 8, 2002 Jheijmans deleted "Talk:John T. Thompson"
- 08:26 Oct 8, 2002 Jheijmans deleted "John T. Thompson"
- 08:25 Oct 8, 2002 Jheijmans deleted "Talk:Kaspar Schlick"
- 08:25 Oct 8, 2002 Jheijmans deleted "Kaspar Schlick"
- 07:45 Oct 8, 2002 Maveric149 deleted "Manned space mission"
- 06:53 Oct 8, 2002 Jheijmans deleted "Lost Jerusalem"
- 06:52 Oct 8, 2002 Jheijmans deleted "Eldridge"
- 06:52 Oct 8, 2002 Jheijmans deleted "Neo Jerusalem"
- 06:51 Oct 8, 2002 Jheijmans deleted "Aveh"
- 06:40 Oct 8, 2002 Maveric149 deleted "Rubber tire"
- 06:40 Oct 8, 2002 WojPob deleted "APHMEC"
- 06:34 Oct 8, 2002 Jheijmans deleted "Teddy Flack"
- 06:33 Oct 8, 2002 Jheijmans deleted "Non-zero-sum games"
- 06:32 Oct 8, 2002 Jheijmans deleted "Description"
- 06:25 Oct 8, 2002 Jheijmans deleted "Meet in the middle"
- 06:25 Oct 8, 2002 Jheijmans deleted "Miniscule"
- 06:24 Oct 8, 2002 Jheijmans deleted "Joseph-Marie Jacquard"
- 06:23 Oct 8, 2002 Jheijmans deleted "William Bradford"
- 06:23 Oct 8, 2002 Jheijmans deleted "Hokkien"
- 06:23 Oct 8, 2002 Jheijmans deleted "Fad"
- 06:22 Oct 8, 2002 Jheijmans deleted "Dahab, Egypt"
- 05:45 Oct 8, 2002 Maveric149 deleted "Argon/Temp"
- 03:18 Oct 8, 2002 Maveric149 deleted "Kristin Otto"
- 02:18 Oct 8, 2002 Brion VIBBER deleted "Hadrian's Wall"
- 01:20 Oct 8, 2002 Maveric149 deleted "Jian"
- 01:18 Oct 8, 2002 Maveric149 deleted "Cape Town"
- 00:10 Oct 8, 2002 Andre Engels deleted "Berger Roy Al"
- 00:08 Oct 8, 2002 Andre Engels deleted "Anarcosocial-communism"
- 00:08 Oct 8, 2002 Andre Engels deleted "Loyda Morales"
- 00:07 Oct 8, 2002 Andre Engels deleted "Bonneville Apartments"
- 23:56 Oct 7, 2002 Maveric149 deleted "London College of Fashion"
- 23:44 Oct 7, 2002 Maveric149 deleted "Mustard agent"
- 23:42 Oct 7, 2002 Maveric149 deleted "Pacific loon"
- 23:08 Oct 7, 2002 Maveric149 deleted "Party congress of the CPSU"
- 23:03 Oct 7, 2002 Maveric149 deleted "Law of Canada"
- 22:14 Oct 7, 2002 Lee Daniel Crocker deleted "WINE"
- 21:34 Oct 7, 2002 Tarquin deleted "Madame Grey"
- 17:51 Oct 7, 2002 Jheijmans deleted "Luxembourg/Temp"
- 15:04 Oct 7, 2002 PierreAbbat deleted "S�Archittu"
- 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons (temp)"
- 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons"
- 14:10 Oct 7, 2002 Jheijmans deleted "Nagoya"
- 13:38 Oct 7, 2002 PierreAbbat deleted "S�Archittu"
- 13:27 Oct 7, 2002 Jheijmans deleted "Talk:North Brabant/Temp"
- 13:27 Oct 7, 2002 Jheijmans deleted "North Brabant/Temp"
- 13:24 Oct 7, 2002 WojPob deleted "Defence Intelligence Agency"
- 11:06 Oct 7, 2002 Tarquin deleted "Mole (espianoge)"
- 10:33 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg"
- 10:32 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png"
- 10:29 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg"
- 10:27 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png"
- 07:57 Oct 7, 2002 Isis deleted "Beverly K Effinger"
- 07:54 Oct 7, 2002 Jheijmans deleted "Guido Carli"
- 06:59 Oct 7, 2002 Jheijmans deleted "Djibouti/Temp"
- 06:57 Oct 7, 2002 Maveric149 deleted "Zebulun Kurth-Nelson"
- 06:53 Oct 7, 2002 Maveric149 deleted "Clark Prensoil Potter"
- 06:52 Oct 7, 2002 Maveric149 deleted "Spoken game"
- 06:32 Oct 7, 2002 Jheijmans deleted "Airglow"
- 06:32 Oct 7, 2002 Jheijmans deleted "Interjection"
- 06:31 Oct 7, 2002 Jheijmans deleted "Babington Conspiracy"
- 06:31 Oct 7, 2002 Jheijmans deleted "Executive department"
- 06:30 Oct 7, 2002 Jheijmans deleted "Second Athenian Empire"
- 06:30 Oct 7, 2002 Jheijmans deleted "Stirrer"
- 05:53 Oct 7, 2002 WojPob deleted "Chinese grammar"
- 04:26 Oct 7, 2002 Maveric149 deleted "Sexual perversion"
- 01:50 Oct 7, 2002 Andre Engels deleted "Walter Benjamin"
- 01:48 Oct 7, 2002 Andre Engels deleted "Canandaigua, New York"
- 01:45 Oct 7, 2002 Andre Engels deleted "One-party system"
- 01:34 Oct 7, 2002 Stephen Gilbert deleted "Logos and slogans"
- 23:43 Oct 6, 2002 Maveric149 deleted "Rod Carew"
- 23:40 Oct 6, 2002 Maveric149 deleted "Central heating"
- 23:36 Oct 6, 2002 Maveric149 deleted "Internet service provider"
- 21:50 Oct 6, 2002 Tarquin deleted "National Trust (England, Wales and Northern Ireland) properties"
- 21:45 Oct 6, 2002 Tarquin deleted "Parse tree"
- 19:56 Oct 6, 2002 Jheijmans deleted "Ellobiopsids"
- 19:56 Oct 6, 2002 Jheijmans deleted "Spoken game"
- 19:55 Oct 6, 2002 Jheijmans deleted "Olga Pyleva"
- 19:55 Oct 6, 2002 Jheijmans deleted "New Ipswich, New Hampshire"
- 19:55 Oct 6, 2002 Jheijmans deleted "A00 Sokolsky Opening 1.e4 e5"
- 11:08 Oct 6, 2002 Maveric149 deleted "Krypton/Temp"
- 10:32 Oct 6, 2002 WojPob deleted "Tezpur, Assam"
- 10:30 Oct 6, 2002 WojPob deleted "Stephen King/Dolans Cadillac"
- 07:36 Oct 6, 2002 Koyaanis Qatsi deleted "Not Black supremacy"
- 07:17 Oct 6, 2002 Jheijmans deleted "Mythology of demons"
- 07:16 Oct 6, 2002 Jheijmans deleted "Babington Conspiracy"
- 07:15 Oct 6, 2002 Jheijmans deleted "Diplomonads"
- 07:15 Oct 6, 2002 Jheijmans deleted "Moose Jaw"
- 07:15 Oct 6, 2002 Jheijmans deleted "1 E21 m"
- 07:14 Oct 6, 2002 Jheijmans deleted "Florianus"
- 21:37 Oct 5, 2002 Brion VIBBER deleted "Junk page that is being deleted to confirm bug is fixed"
- 23:15 Oct 5, 2002 WojPob deleted "Mass Production"
- 09:51 Oct 5, 2002 Maveric149 deleted "Helsinki"
- 14:13 Oct 5, 2002 The Epopt deleted "C-46 Commando"
- 14:13 Oct 5, 2002 The Epopt deleted "C-47 Skytrain"
- 14:29 Oct 5, 2002 Scipius deleted "Das Kapital"
- 06:19 Oct 5, 2002 Maveric149 deleted "Human"
- 06:17 Oct 5, 2002 Maveric149 deleted "Humans"
- 13:10 Oct 5, 2002 Scipius deleted "Testingwhetherthereisalimittothelengthsofpagenamesddlskdlaskdnvlknancsklnasnfdoaiwnrpiwnrpqnrpqwnrpiqnneifniqnfiqwnipqwnfiqwnfiqwnfpiwqnfpinfipqnfipqwnfipnqwfpniwnfqpmmqcpomowmcmcopqwmpowcmopqwmcoqwpmcowpqmcopqmwcopwmcopmqcwopmcopqmwocpmwocmopcwqmopwqmcop"
- 19:26 Oct 4, 2002 Maveric149 deleted "Wikipedia:Tom Tommorrow"
- 21:44 Oct 4, 2002 Tarquin deleted "Coppicing/pollarding"
- 22:58 Oct 4, 2002 Ed Poor deleted "SPIHT"
- 20:35 Oct 4, 2002 Jheijmans deleted "Horace de Saussure"
- 20:35 Oct 4, 2002 Jheijmans deleted "Cisternae"
- 20:35 Oct 4, 2002 Jheijmans deleted "Israeli Security Zone"
- 20:35 Oct 4, 2002 Jheijmans deleted "United Nations Partition Plan"
- 17:39 Oct 4, 2002 Koyaanis Qatsi deleted ".phtml"
- 18:43 Oct 4, 2002 Ed Poor deleted "State sponsors of terrorism"
- 17:43 Oct 4, 2002 Jheijmans deleted "Ghent"
- 12:55 Oct 4, 2002 Andre Engels deleted "Pearson Hashing"
- 12:37 Oct 4, 2002 Andre Engels deleted "Duck duck goose"
- 12:05 Oct 4, 2002 Jheijmans deleted "Exchange rate"
- 11:10 Oct 4, 2002 Andre Engels deleted "Red Sonja"
- 11:07 Oct 4, 2002 Andre Engels deleted "Johan Helsingius"
- 11:01 Oct 4, 2002 Andre Engels deleted "I didn't change anything!"
- 08:54 Oct 4, 2002 Jheijmans deleted "Emotional punditry"
- 08:54 Oct 4, 2002 Jheijmans deleted "Environmental wacko"
- 08:51 Oct 4, 2002 Jheijmans deleted "StarEdit"
- 08:49 Oct 4, 2002 Jheijmans deleted "Thames/pollution"
- 08:45 Oct 4, 2002 Jheijmans deleted "Ekumen"
- 08:44 Oct 4, 2002 Jheijmans deleted "The Dispossessed"
- 08:34 Oct 4, 2002 Jheijmans deleted "Vitamin E familial isolated, deficiency of"
- 08:34 Oct 4, 2002 Jheijmans deleted "Clara Thrupp"
- 08:33 Oct 4, 2002 Jheijmans deleted "Eric Hoffman"
- 08:32 Oct 4, 2002 Jheijmans deleted "Talk:Belief"
- 08:32 Oct 4, 2002 Jheijmans deleted "Belief"
- 08:31 Oct 4, 2002 Jheijmans deleted "Carol"
- 08:29 Oct 4, 2002 Jheijmans deleted "Dinant"
- 08:29 Oct 4, 2002 Jheijmans deleted "Stevertigo"
- 08:29 Oct 4, 2002 Jheijmans deleted "Secret key"
- 08:29 Oct 4, 2002 Jheijmans deleted "Dorchester, England"
- 08:29 Oct 4, 2002 Jheijmans deleted "G3"
- 08:28 Oct 4, 2002 Jheijmans deleted "Philosophical Investigations/family resemblance"
- 08:28 Oct 4, 2002 Jheijmans deleted "Aswan High Dam"
- 08:28 Oct 4, 2002 Jheijmans deleted "U.s. presidental election, 1948"
- 08:27 Oct 4, 2002 Jheijmans deleted "Sunset"
- 08:27 Oct 4, 2002 Jheijmans deleted "TWA 847 hijacking"
- 06:22 Oct 4, 2002 Brion VIBBER deleted "Green economics"
- 08:18 Oct 4, 2002 WojPob deleted "Howdoudeleteapage"
- 23:58 Oct 3, 2002 Brion VIBBER deleted "Green Economism"
- 19:15 Oct 3, 2002 Jheijmans deleted "Existentialism/Old"
- 18:27 Oct 3, 2002 Jheijmans deleted "Toe"
- 18:26 Oct 3, 2002 Jheijmans deleted "Electrostatic field"
- 18:25 Oct 3, 2002 Jheijmans deleted "Henri D�sir� Landru"
- 18:24 Oct 3, 2002 Jheijmans deleted "Marcel Petiot"
- 10:27 Oct 3, 2002 Brion VIBBER deleted "Santa Cruz Operation"
- 12:16 Oct 3, 2002 Jheijmans deleted "Adzuki bean"
- 11:48 Oct 3, 2002 Jheijmans deleted "Obfuscating software"
- 10:28 Oct 3, 2002 Tarquin deleted "Hazaed (game)"
- 11:19 Oct 3, 2002 Jheijmans deleted "Brazil's anthem, entitled Hino Nacional Brasileiro"
- 09:10 Oct 3, 2002 Jheijmans deleted "San Marino/Temp"
- 09:01 Oct 3, 2002 Jheijmans deleted "Seth Howard"
- 09:01 Oct 3, 2002 Jheijmans deleted "Weak entity"
- 09:00 Oct 3, 2002 Jheijmans deleted "Philip III of Spain"
- 08:58 Oct 3, 2002 Jheijmans deleted "Charles Spurgeon"
- 08:57 Oct 3, 2002 Jheijmans deleted "Hans Eijsackers"
- 08:57 Oct 3, 2002 Jheijmans deleted "Morals or Ethics"
- 08:56 Oct 3, 2002 Jheijmans deleted "Curved Air"
- 08:56 Oct 3, 2002 Jheijmans deleted "Bad Religion"
- 08:55 Oct 3, 2002 Jheijmans deleted "Pcl"
- 08:55 Oct 3, 2002 Jheijmans deleted "Meersburg"
- 08:54 Oct 3, 2002 Jheijmans deleted "Mainau Island"
- 08:54 Oct 3, 2002 Jheijmans deleted "Hugh Richardson"
- 08:53 Oct 3, 2002 Jheijmans deleted "Andra� Crouch"
- 08:53 Oct 3, 2002 Jheijmans deleted "Battle of Lexington and Concord"
- 08:52 Oct 3, 2002 Jheijmans deleted "Flight AF 8969 Alger-Paris hijacked"
- 08:50 Oct 3, 2002 Jheijmans deleted "University of Kiel"
- 08:50 Oct 3, 2002 Jheijmans deleted "Yang di-Pertuan Agong"
- 23:48 Oct 2, 2002 Maveric149 deleted "Predicate calculus"
- 23:46 Oct 2, 2002 Maveric149 deleted "Radon/Temp"
- 19:47 Oct 2, 2002 PierreAbbat deleted "Battle of Lutzen"
- 19:45 Oct 2, 2002 PierreAbbat deleted "Talk:Electronic filter"
- 19:15 Oct 2, 2002 PierreAbbat deleted "Blue Gene"
- 01:43 Oct 3, 2002 Andre Engels deleted "Roman emperor"
- 22:00 Oct 2, 2002 Brion VIBBER deleted "Peasants' Revolt"
- 23:29 Oct 2, 2002 Andre Engels deleted "Port Royal"
- 21:47 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
- 21:40 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
- 22:43 Oct 2, 2002 -- April deleted "Antiwikipedic"
- 22:27 Oct 2, 2002 -- April deleted "Antiwikipedic"
- 20:28 Oct 2, 2002 -- April deleted "Antiwikipedic"
- 20:24 Oct 2, 2002 -- April deleted "Antiwikipedic"
- 20:09 Oct 2, 2002 -- April deleted "Wikipedic"
- 20:08 Oct 2, 2002 -- April deleted "Wikipedia: Antiwikipedic"
- 20:07 Oct 2, 2002 -- April deleted "Antiwikipedic"
- 19:52 Oct 2, 2002 -- April deleted "Antiwikipedic"
- 15:54 Oct 2, 2002 Koyaanis Qatsi deleted "Antiwikipedic"
- 15:43 Oct 2, 2002 Koyaanis Qatsi deleted "AntiWikipedic"
- 00:42 Oct 3, 2002 Stephen Gilbert deleted "Stephen Gilbert"
- 00:32 Oct 3, 2002 Stephen Gilbert deleted "STG"
- 17:01 Oct 2, 2002 Andre Engels deleted "Laurasia"
- 16:52 Oct 2, 2002 Andre Engels deleted "CTSS"
- 16:17 Oct 2, 2002 Jheijmans deleted "Maurice"
- 14:01 Oct 2, 2002 Andre Engels deleted "Riptor's articles"
- 09:20 Oct 2, 2002 Jheijmans deleted "Transaction processing"
- 09:08 Oct 2, 2002 Jheijmans deleted "In Vitro Fertilisation/Todo"
- 08:50 Oct 2, 2002 Andre Engels deleted "Global warming/Todo"
- 08:45 Oct 2, 2002 Jheijmans deleted "Fuller Theological Seminary"
- 08:23 Oct 2, 2002 Jheijmans deleted "Pseudorandom"
- 08:22 Oct 2, 2002 Jheijmans deleted "Vaux-le-Vicomte"
- 08:21 Oct 2, 2002 Jheijmans deleted "Ann Theresa de Keersmaker"
- 23:21 Oct 1, 2002 Maveric149 deleted "Barney Rubble"
- 23:00 Oct 1, 2002 Maveric149 deleted "Ned Ludd"
- 23:00 Oct 1, 2002 Maveric149 deleted "Self-starvation"
- 22:57 Oct 1, 2002 Maveric149 deleted "Middle High German"
- 22:54 Oct 1, 2002 Maveric149 deleted "Aeolic"
- 22:53 Oct 1, 2002 Maveric149 deleted "Oliver Ellsworth"
- 22:52 Oct 1, 2002 Maveric149 deleted "HMAS Darwin"
- 22:52 Oct 1, 2002 Maveric149 deleted "Chemical burn"
- 22:51 Oct 1, 2002 Maveric149 deleted "Fluoride"
- 18:57 Oct 1, 2002 Andre Engels deleted "Stem cell/Todo"
- 01:06 Oct 2, 2002 Stephen Gilbert deleted "Wikipedia talk:What Google Likes"
- 09:57 Oct 1, 2002 Tarquin deleted "Guiness Book of World Records"
- 10:39 Oct 1, 2002 Jheijmans deleted "Peat bog"
- 09:50 Oct 1, 2002 Jheijmans deleted "Ashtanga Yoga"