Wikipedia:Deletion log archive/October 2002

From Wikipedia, the free encyclopedia

[edit] Wikipedia:Deletion log Archive for October 2002 (936 deletions)

  1. 22:08 Oct 31, 2002 Maveric149 deleted "Computer keyboard"
  2. 20:47 Oct 31, 2002 Tarquin deleted "Solar tower"
  3. 15:55 Oct 31, 2002 Jheijmans deleted "Modern Pentathlon at the 1936 Summer Olympics"
  4. 09:43 Oct 31, 2002 Magnus Manske deleted "Saint-Cyr"
  5. 08:46 Oct 31, 2002 Magnus Manske deleted "Data storage"
  6. 08:11 Oct 31, 2002 Jheijmans deleted "Liar (short story)"
  7. 08:11 Oct 31, 2002 Jheijmans deleted "Sumerian Early Dynastic period"
  8. 08:10 Oct 31, 2002 Jheijmans deleted "Analog first generation"
  9. 08:10 Oct 31, 2002 Jheijmans deleted "Automaton"
  10. 08:10 Oct 31, 2002 Jheijmans deleted "State diagram"
  11. 08:10 Oct 31, 2002 Jheijmans deleted "Talk:2209"
  12. 08:10 Oct 31, 2002 Jheijmans deleted "2209"
  13. 08:09 Oct 31, 2002 Jheijmans deleted "Turing reduction"
  14. 08:09 Oct 31, 2002 Jheijmans deleted "Kitakyushu"
  15. 08:08 Oct 31, 2002 Jheijmans deleted "Fraser River"
  16. 08:08 Oct 31, 2002 Jheijmans deleted "La Cliqua"
  17. 08:07 Oct 31, 2002 Jheijmans deleted "Ad hoc protocol list"
  18. 07:37 Oct 31, 2002 JeLuF deleted "Sir Andrew Ramsay"
  19. 07:37 Oct 31, 2002 JeLuF deleted "Synonymy"
  20. 06:48 Oct 31, 2002 Sjc deleted "Peter Tosh"
  21. 05:32 Oct 31, 2002 Brion VIBBER deleted "Christian Dior"
  22. 05:22 Oct 31, 2002 Maveric149 deleted "Rhenium/Temp"
  23. 03:36 Oct 31, 2002 PierreAbbat deleted "Richard Leakey"
  24. 23:58 Oct 30, 2002 PierreAbbat deleted "Charles's law"
  25. 22:55 Oct 30, 2002 The Epopt deleted "Agosta 90B class submarine"
  26. 20:36 Oct 30, 2002 JeLuF deleted "Olde Cheshire Cheese (London pub)"
  27. 20:35 Oct 30, 2002 JeLuF deleted "Top-down"
  28. 20:34 Oct 30, 2002 JeLuF deleted "Nearest neighbor algorithm"
  29. 20:33 Oct 30, 2002 JeLuF deleted "Dog whistle"
  30. 20:32 Oct 30, 2002 JeLuF deleted "Sforzando"
  31. 18:57 Oct 30, 2002 Tarquin deleted "BLT sandwitch"
  32. 18:56 Oct 30, 2002 Tarquin deleted "BLT sandwich"
  33. 18:54 Oct 30, 2002 Tarquin deleted "Club sandwich"
  34. 15:51 Oct 30, 2002 Tarquin deleted "N'Djamena"
  35. 15:50 Oct 30, 2002 Ed Poor deleted "Renaming page, as suggested"
  36. 15:46 Oct 30, 2002 Tarquin deleted "WikiWiki)"
  37. 15:37 Oct 30, 2002 Magnus Manske deleted "WikiWiki)"
  38. 12:52 Oct 30, 2002 Brion VIBBER deleted "CMOS Memory"
  39. 12:14 Oct 30, 2002 Tarquin deleted "Nipple piercing"
  40. 10:50 Oct 30, 2002 Jheijmans deleted "De Witt Clinton"
  41. 10:50 Oct 30, 2002 Jheijmans deleted "Preda Mihailescu"
  42. 10:50 Oct 30, 2002 Jheijmans deleted "When it Happens"
  43. 10:49 Oct 30, 2002 Jheijmans deleted "Mossel Bay"
  44. 04:32 Oct 30, 2002 Brion VIBBER deleted "Zu Chen"
  45. 04:32 Oct 30, 2002 Brion VIBBER deleted "Jun Xie"
  46. 01:28 Oct 30, 2002 PierreAbbat deleted "Henri D�sir� Landru"
  47. 23:10 Oct 29, 2002 Brion VIBBER deleted "Mercury-in-glass thermometer"
  48. 23:01 Oct 29, 2002 PierreAbbat deleted "Thylakoid"
  49. 22:54 Oct 29, 2002 PierreAbbat deleted "Image:Vaag.JPG"
  50. 21:26 Oct 29, 2002 Jheijmans deleted "Edit"
  51. 21:26 Oct 29, 2002 Jheijmans deleted "Tramping"
  52. 20:20 Oct 29, 2002 JeLuF deleted "Lloyd Bentsen"
  53. 19:21 Oct 29, 2002 Tarquin deleted "Harry Potter and the Order of the Phoenix"
  54. 17:32 Oct 29, 2002 Ed Poor deleted "Moscow theatre siege"
  55. 13:59 Oct 29, 2002 Brion VIBBER deleted "Hitler: The Last Ten Days"
  56. 13:52 Oct 29, 2002 Brion VIBBER deleted "Battle of Otford"
  57. 13:31 Oct 29, 2002 Brion VIBBER deleted "Talk:Hafez al-Assad"
  58. 13:30 Oct 29, 2002 Brion VIBBER deleted "Image talk:Hitler.jpg"
  59. 13:27 Oct 29, 2002 Brion VIBBER deleted "Sukarno"
  60. 13:26 Oct 29, 2002 Brion VIBBER deleted "Suharto"
  61. 11:26 Oct 29, 2002 Karen Johnson deleted "X/Open"
  62. 10:00 Oct 29, 2002 Karen Johnson deleted "Peasant rebellion"
  63. 09:53 Oct 29, 2002 Karen Johnson deleted "University of Birmingham"
  64. 09:51 Oct 29, 2002 Karen Johnson deleted "Dictionary of the Norwegian Dialects"
  65. 09:14 Oct 29, 2002 Brion VIBBER deleted "St. Paul's Cathedral"
  66. 07:52 Oct 29, 2002 Jheijmans deleted "Bob Kane"
  67. 07:13 Oct 29, 2002 JeLuF deleted "Pi-calculus"
  68. 07:13 Oct 29, 2002 JeLuF deleted "Dwarf elliptical galaxy"
  69. 05:23 Oct 29, 2002 AxelBoldt deleted "Post system"
  70. 04:21 Oct 29, 2002 Koyaanis Qatsi deleted "Image:Aalayout.jpg"
  71. 03:27 Oct 29, 2002 PierreAbbat deleted "0001 B.C."
  72. 03:24 Oct 29, 2002 PierreAbbat deleted "Talk:Hydroelectricity"
  73. 03:23 Oct 29, 2002 PierreAbbat deleted "Archaism"
  74. 03:09 Oct 29, 2002 Karen Johnson deleted "Image:Marigoldthumbnail.pg.jpg"
  75. 03:07 Oct 29, 2002 Karen Johnson deleted "Mechanical energy"
  76. 03:06 Oct 29, 2002 Karen Johnson deleted "Breach of contract"
  77. 03:06 Oct 29, 2002 Karen Johnson deleted "Isolating language"
  78. 03:05 Oct 29, 2002 Karen Johnson deleted "Gush Shalom"
  79. 03:05 Oct 29, 2002 Karen Johnson deleted "Push-down automaton"
  80. 03:04 Oct 29, 2002 Karen Johnson deleted "Morrill act"
  81. 01:03 Oct 29, 2002 Tarquin deleted "OMW"
  82. 19:43 Oct 28, 2002 JeLuF deleted "Free Software movement"
  83. 18:23 Oct 28, 2002 Jheijmans deleted "Fabio"
  84. 18:22 Oct 28, 2002 Jheijmans deleted "Application server"
  85. 15:56 Oct 28, 2002 Ed Poor deleted "Unification Church and anti-Semitism"
  86. 15:49 Oct 28, 2002 Tarquin deleted "Cut in"
  87. 14:12 Oct 28, 2002 Jheijmans deleted "Rembrandt"
  88. 12:51 Oct 28, 2002 Magnus Manske deleted "Asian crisis"
  89. 08:10 Oct 28, 2002 Maveric149 deleted "Nonviolence"
  90. 07:53 Oct 28, 2002 Jheijmans deleted "Andorra la Vella"
  91. 06:51 Oct 28, 2002 Karen Johnson deleted "Mitochondrial membrane"
  92. 06:40 Oct 28, 2002 Karen Johnson deleted "Michigan Rummy"
  93. 06:10 Oct 28, 2002 Karen Johnson deleted "The war against Reform and Conservative Judaism"
  94. 06:03 Oct 28, 2002 Koyaanis Qatsi deleted "David Matthews"
  95. 05:50 Oct 28, 2002 Karen Johnson deleted "Demagoguery"
  96. 05:47 Oct 28, 2002 Karen Johnson deleted "Motor coil resistance"
  97. 05:40 Oct 28, 2002 Karen Johnson deleted "Hollywood Babylon"
  98. 05:40 Oct 28, 2002 Karen Johnson deleted "Tax evasion"
  99. 05:39 Oct 28, 2002 PierreAbbat deleted "Progenote"
  100. 05:39 Oct 28, 2002 Karen Johnson deleted "Progenote"
  101. 05:38 Oct 28, 2002 Karen Johnson deleted "Tollund"
  102. 05:37 Oct 28, 2002 Karen Johnson deleted "Meet in the middle"
  103. 05:26 Oct 28, 2002 PierreAbbat deleted "Lock and key"
  104. 02:53 Oct 28, 2002 Maveric149 deleted "Spindle"
  105. 02:24 Oct 28, 2002 Karen Johnson deleted "Talk:Mystery"
  106. 01:13 Oct 28, 2002 Isis deleted "Image:Tartan.PNG"
  107. 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg"
  108. 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg"
  109. 22:58 Oct 27, 2002 PierreAbbat deleted "Colouring algorithm"
  110. 22:04 Oct 27, 2002 Jheijmans deleted "Frederick II of Naples"
  111. 21:10 Oct 27, 2002 Jheijmans deleted "Shopping mall"
  112. 20:20 Oct 27, 2002 Scipius deleted "Estonia/Temp"
  113. 19:45 Oct 27, 2002 JeLuF deleted "Black widow spider"
  114. 19:37 Oct 27, 2002 Maveric149 deleted "Fort Garry"
  115. 17:17 Oct 27, 2002 JeLuF deleted "Fluorescent light"
  116. 17:15 Oct 27, 2002 JeLuF deleted "Rollie Fingers"
  117. 17:13 Oct 27, 2002 JeLuF deleted "Dogrib"
  118. 17:06 Oct 27, 2002 JeLuF deleted "Page Widening"
  119. 14:28 Oct 27, 2002 Magnus Manske deleted "Image:Soldierwithwings thumb.htm"
  120. 12:31 Oct 27, 2002 Jheijmans deleted "User:Jheijmans/Zandbak"
  121. 12:03 Oct 27, 2002 Jheijmans deleted "Quantum dot computer"
  122. 12:02 Oct 27, 2002 Jheijmans deleted "Joel David Bondurant"
  123. 12:01 Oct 27, 2002 Jheijmans deleted "Kassubian"
  124. 08:34 Oct 27, 2002 JeLuF deleted "Goddess of Democracy"
  125. 07:41 Oct 27, 2002 Maveric149 deleted "John Wilkins"
  126. 03:13 Oct 27, 2002 Brion VIBBER deleted "Basidium"
  127. 03:09 Oct 27, 2002 Brion VIBBER deleted "Espionage Act"
  128. 02:34 Oct 27, 2002 PierreAbbat deleted "Eurpoean"
  129. 01:10 Oct 27, 2002 PierreAbbat deleted "Talk:Francesco Andreini"
  130. 22:04 Oct 26, 2002 Maveric149 deleted "User:194.117.133.196"
  131. 21:58 Oct 26, 2002 Maveric149 deleted "Hilary rosen"
  132. 21:57 Oct 26, 2002 Maveric149 deleted "Excrement"
  133. 21:57 Oct 26, 2002 Maveric149 deleted "Contructophobia"
  134. 21:56 Oct 26, 2002 Maveric149 deleted "0o0o0o0o0o0o0o0o0o0"
  135. 21:55 Oct 26, 2002 Maveric149 deleted "WikiWikiWikiWiki"
  136. 21:05 Oct 26, 2002 Maveric149 deleted "Greek Orthodox"
  137. 20:01 Oct 26, 2002 Danny deleted "Hormizd II of Persai"
  138. 18:56 Oct 26, 2002 Scipius deleted "Jules Bonnot"
  139. 15:17 Oct 26, 2002 Jheijmans deleted "Zacharias Janssen"
  140. 15:16 Oct 26, 2002 Jheijmans deleted "Krankenhaus"
  141. 15:15 Oct 26, 2002 Jheijmans deleted "Mayan hieroglyph"
  142. 15:15 Oct 26, 2002 Jheijmans deleted "MIPS architecture/Instructions"
  143. 15:14 Oct 26, 2002 Jheijmans deleted "PC-DOS"
  144. 14:15 Oct 26, 2002 Jheijmans deleted "China/Temp"
  145. 12:52 Oct 26, 2002 Jheijmans deleted "Ancient Roman eschatology"
  146. 12:52 Oct 26, 2002 Jheijmans deleted "Albert Luthuli"
  147. 12:09 Oct 26, 2002 JeLuF deleted "Matabele"
  148. 07:18 Oct 26, 2002 JeLuF deleted "Mars bar"
  149. 07:17 Oct 26, 2002 JeLuF deleted "IEEE 802.10"
  150. 05:18 Oct 26, 2002 The Cunctator deleted "Image:Paul Wellstone.jpg"
  151. 22:41 Oct 25, 2002 Ed Poor deleted "Talk:Ded reckoning"
  152. 22:09 Oct 25, 2002 JeLuF deleted "Mo Vaughn"
  153. 22:08 Oct 25, 2002 JeLuF deleted "Wally Joyner"
  154. 21:03 Oct 25, 2002 JeLuF deleted "Mark Shuttleworth"
  155. 21:00 Oct 25, 2002 JeLuF deleted "Portal circulation"
  156. 20:51 Oct 25, 2002 JeLuF deleted "Random number generator"
  157. 20:13 Oct 25, 2002 Tarquin deleted "Babylonian numerals"
  158. 19:16 Oct 25, 2002 Sjc deleted "User:193.251.9.132 is back for more"
  159. 19:15 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg"
  160. 19:15 Oct 25, 2002 Sjc deleted "Image:Hello.jpg"
  161. 19:12 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Widening"
  162. 19:01 Oct 25, 2002 Koyaanis Qatsi deleted "Wikipedia:Ram-man"
  163. 18:49 Oct 25, 2002 Sjc deleted [redacted]
  164. 18:43 Oct 25, 2002 Koyaanis Qatsi deleted [redacted]
  165. 18:29 Oct 25, 2002 Jheijmans deleted "Path integral"
  166. 18:29 Oct 25, 2002 Jheijmans deleted "Statistical distribution"
  167. 18:28 Oct 25, 2002 Jheijmans deleted "Precious metal"
  168. 18:26 Oct 25, 2002 Jheijmans deleted "Joel David Bondurant"
  169. 18:26 Oct 25, 2002 Jheijmans deleted "Buffalo Bill"
  170. 18:26 Oct 25, 2002 Jheijmans deleted "Phylogenetic tree"
  171. 18:26 Oct 25, 2002 Jheijmans deleted "Residue"
  172. 18:25 Oct 25, 2002 Jheijmans deleted "Distance-vector routing protocol"
  173. 18:25 Oct 25, 2002 Jheijmans deleted "Concordance"
  174. 18:22 Oct 25, 2002 Jheijmans deleted "Cross-country running"
  175. 18:21 Oct 25, 2002 Jheijmans deleted "Royal Tombs of Ur"
  176. 18:21 Oct 25, 2002 Jheijmans deleted "Pictograph"
  177. 18:21 Oct 25, 2002 Jheijmans deleted "Allotheria"
  178. 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation"
  179. 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation"
  180. 18:20 Oct 25, 2002 Jheijmans deleted "Cape Fear"
  181. 18:20 Oct 25, 2002 Jheijmans deleted "Pierre Sauvignon de Brazza"
  182. 15:50 Oct 25, 2002 Andre Engels deleted "Sulfide"
  183. 15:48 Oct 25, 2002 Andre Engels deleted "Cupper sulfide"
  184. 09:35 Oct 25, 2002 Magnus Manske deleted "Markov algorithm"
  185. 08:47 Oct 25, 2002 Karen Johnson deleted "Mahmud I"
  186. 00:27 Oct 25, 2002 Koyaanis Qatsi deleted "Locro"
  187. 00:26 Oct 25, 2002 Koyaanis Qatsi deleted "Marching music"
  188. 21:18 Oct 24, 2002 JeLuF deleted "On-Line Medical Dictionary"
  189. 21:17 Oct 24, 2002 JeLuF deleted "Bureau of Standards"
  190. 21:16 Oct 24, 2002 JeLuF deleted "Frozen Four"
  191. 21:15 Oct 24, 2002 JeLuF deleted "The Fall of the House of Usher"
  192. 21:13 Oct 24, 2002 JeLuF deleted "Minbar"
  193. 21:13 Oct 24, 2002 JeLuF deleted "John Purroy Mitchel"
  194. 21:12 Oct 24, 2002 JeLuF deleted "FFS"
  195. 18:50 Oct 24, 2002 The Cunctator deleted "Talk:Beltway Sniper"
  196. 18:49 Oct 24, 2002 The Cunctator deleted "Beltway Sniper"
  197. 17:26 Oct 24, 2002 Ed Poor deleted "Keep on trollin trollin trollin"
  198. 17:23 Oct 24, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg"
  199. 14:08 Oct 24, 2002 Jheijmans deleted "Sunne"
  200. 13:42 Oct 24, 2002 Jheijmans deleted "-lvsbyn"
  201. 13:14 Oct 24, 2002 Jheijmans deleted "Berg"
  202. 08:01 Oct 24, 2002 Koyaanis Qatsi deleted "THX 1138:4EB"
  203. 07:42 Oct 24, 2002 Jheijmans deleted "Rustler's knot"
  204. 07:41 Oct 24, 2002 Jheijmans deleted "Duotrigintillion"
  205. 07:41 Oct 24, 2002 Jheijmans deleted "Mudhoney"
  206. 07:40 Oct 24, 2002 Jheijmans deleted "Geheimfernschreiber"
  207. 07:40 Oct 24, 2002 Jheijmans deleted "Projection"
  208. 07:40 Oct 24, 2002 Jheijmans deleted "Channel 5/UK"
  209. 06:54 Oct 24, 2002 Brion VIBBER deleted "Simon peters"
  210. 04:07 Oct 24, 2002 Brion VIBBER deleted "Waring's problem"
  211. 03:08 Oct 24, 2002 Brion VIBBER deleted "Propaganda/Slogans"
  212. 00:02 Oct 24, 2002 Lee Daniel Crocker deleted "Fred Olsen"
  213. 00:00 Oct 24, 2002 Lee Daniel Crocker deleted "James Rosenquist"
  214. 23:22 Oct 23, 2002 Lee Daniel Crocker deleted "Minoan civilization"
  215. 22:26 Oct 23, 2002 Brion VIBBER deleted "Logging file system"
  216. 21:08 Oct 23, 2002 Brion VIBBER deleted "Bloomingberg, ohio"
  217. 20:44 Oct 23, 2002 Brion VIBBER deleted "Wikipedia:VANDALISMS IN PROGRESS"
  218. 20:34 Oct 23, 2002 JeLuF deleted "Gonville Hall, Cambridge"
  219. 20:33 Oct 23, 2002 Maveric149 deleted "Spelling"
  220. 20:33 Oct 23, 2002 JeLuF deleted "Morton's Fork"
  221. 20:32 Oct 23, 2002 JeLuF deleted "User:0"
  222. 20:29 Oct 23, 2002 Ed Poor deleted "The weather in London"
  223. 20:21 Oct 23, 2002 JeLuF deleted "Wikipedia:Sucks"
  224. 20:20 Oct 23, 2002 Ed Poor deleted "Wikipedia:Sucks"
  225. 18:27 Oct 23, 2002 Maveric149 deleted "Pyramid of Djoser"
  226. 17:43 Oct 23, 2002 Stephen Gilbert deleted "Compound microscope"
  227. 17:23 Oct 23, 2002 Stephen Gilbert deleted "Tillibody"
  228. 17:22 Oct 23, 2002 Stephen Gilbert deleted "Tagmemics"
  229. 09:59 Oct 23, 2002 Andre Engels deleted "John Fahey"
  230. 08:10 Oct 23, 2002 Jheijmans deleted "Pet Sounds"
  231. 08:10 Oct 23, 2002 Jheijmans deleted "Vince Clarke"
  232. 08:10 Oct 23, 2002 Jheijmans deleted "Charles Augustin de Coulumb"
  233. 08:09 Oct 23, 2002 Jheijmans deleted "Chuck Norris"
  234. 01:23 Oct 23, 2002 Brion VIBBER deleted "Beltway Sniper"
  235. 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Delete"
  236. 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Dqwe"
  237. 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete3432432"
  238. 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete123"
  239. 00:52 Oct 23, 2002 Karen Johnson deleted "Cock"
  240. 00:50 Oct 23, 2002 Karen Johnson deleted "Hillel Slovak"
  241. 00:49 Oct 23, 2002 Karen Johnson deleted "Surf Punks"
  242. 00:48 Oct 23, 2002 Karen Johnson deleted "Bass rap"
  243. 00:47 Oct 23, 2002 Karen Johnson deleted "Sir Andrew Ramsay"
  244. 00:45 Oct 23, 2002 Karen Johnson deleted "Sali Berisha"
  245. 00:42 Oct 23, 2002 Karen Johnson deleted "Petronius"
  246. 00:07 Oct 23, 2002 Andre Engels deleted "Spiral galaxy"
  247. 00:06 Oct 23, 2002 Andre Engels deleted "Cervidae"
  248. 00:05 Oct 23, 2002 Andre Engels deleted "Swiss Market"
  249. 00:03 Oct 23, 2002 Andre Engels deleted "William Rushton"
  250. 19:47 Oct 22, 2002 Tarquin deleted "Lalalalalala"
  251. 19:26 Oct 22, 2002 Andre Engels deleted "Red River (of the South)"
  252. 18:17 Oct 22, 2002 Isis deleted "Image:Janegrey.jpg"
  253. 13:14 Oct 22, 2002 Isis deleted "Matrix(Mathematics)"
  254. 08:38 Oct 22, 2002 PierreAbbat deleted "Grauspitze"
  255. 08:07 Oct 22, 2002 Jheijmans deleted "James Richard Cross"
  256. 08:06 Oct 22, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction"
  257. 08:06 Oct 22, 2002 Jheijmans deleted "2196"
  258. 08:06 Oct 22, 2002 Jheijmans deleted "Hegemon"
  259. 08:06 Oct 22, 2002 Jheijmans deleted "Knuths up-arrow notation"
  260. 08:05 Oct 22, 2002 Jheijmans deleted "Sparks, Nevada"
  261. 08:04 Oct 22, 2002 Jheijmans deleted "Talk:OMW"
  262. 08:03 Oct 22, 2002 Jheijmans deleted "OMW"
  263. 05:39 Oct 22, 2002 Maveric149 deleted "Dispatcher"
  264. 05:07 Oct 22, 2002 Maveric149 deleted "Munich"
  265. 04:47 Oct 22, 2002 Brion VIBBER deleted "Talk:Christopher Columbus"
  266. 04:42 Oct 22, 2002 Brion VIBBER deleted "Christopher Columbus"
  267. 03:25 Oct 22, 2002 Karen Johnson deleted "Gerdy The Dinosaur"
  268. 00:16 Oct 22, 2002 PierreAbbat deleted "Hab Theory"
  269. 00:04 Oct 22, 2002 PierreAbbat deleted "Drez"
  270. 20:51 Oct 21, 2002 Tarquin deleted "Chronicle of a Death Foretold"
  271. 18:18 Oct 21, 2002 Jheijmans deleted "Talk:List of famous people who had sex with animals"
  272. 18:18 Oct 21, 2002 Jheijmans deleted "Talk:Benjamin Netanyahu On Terrorism"
  273. 18:17 Oct 21, 2002 Jheijmans deleted "Talk:Viral meme"
  274. 18:14 Oct 21, 2002 Jheijmans deleted "39/Smooth"
  275. 18:14 Oct 21, 2002 Jheijmans deleted "Kerplunk"
  276. 18:14 Oct 21, 2002 Jheijmans deleted "Alice Cooper"
  277. 18:14 Oct 21, 2002 Jheijmans deleted "PLATO game Spasim"
  278. 18:13 Oct 21, 2002 Jheijmans deleted "Hermann Koehl"
  279. 18:13 Oct 21, 2002 Jheijmans deleted "Hawkwind/Quark, Strangeness and Charm"
  280. 18:11 Oct 21, 2002 Jheijmans deleted "Alexander Girard"
  281. 18:09 Oct 21, 2002 Jheijmans deleted "George Nelson"
  282. 18:09 Oct 21, 2002 Jheijmans deleted "Ray Ozzie"
  283. 18:09 Oct 21, 2002 Jheijmans deleted "Herman Miller"
  284. 18:09 Oct 21, 2002 Jheijmans deleted "Gilbert Rohde"
  285. 18:09 Oct 21, 2002 Jheijmans deleted "Charles and Ray Eames"
  286. 18:09 Oct 21, 2002 Jheijmans deleted "Isamu Noguchi"
  287. 18:08 Oct 21, 2002 Jheijmans deleted "Gary Barwin"
  288. 18:07 Oct 21, 2002 Jheijmans deleted "El Elote"
  289. 18:06 Oct 21, 2002 Jheijmans deleted "Slaughterhouse Five"
  290. 18:06 Oct 21, 2002 Jheijmans deleted "IHTFP"
  291. 18:02 Oct 21, 2002 Jheijmans deleted "Anthony M. Buzzelli"
  292. 18:02 Oct 21, 2002 Jheijmans deleted "The weather in London"
  293. 18:00 Oct 21, 2002 Jheijmans deleted "East of Eden"
  294. 17:02 Oct 21, 2002 Jheijmans deleted "Bergen, Netherlands"
  295. 16:11 Oct 21, 2002 Maveric149 deleted "Munich"
  296. 13:06 Oct 21, 2002 Karen Johnson deleted "Motorola 68012"
  297. 12:03 Oct 21, 2002 Jheijmans deleted "Frederic Rzewski"
  298. 12:02 Oct 21, 2002 Jheijmans deleted "Platonic dialogues"
  299. 12:02 Oct 21, 2002 Jheijmans deleted "Larry Brown"
  300. 11:58 Oct 21, 2002 PierreAbbat deleted "KWOC"
  301. 07:02 Oct 21, 2002 Maveric149 deleted "Hybrid monolithic kernel"
  302. 07:02 Oct 21, 2002 Maveric149 deleted "Bus mastering"
  303. 05:36 Oct 21, 2002 Maveric149 deleted "Tungsten/Temp"
  304. 04:40 Oct 21, 2002 Maveric149 deleted "Middle German"
  305. 04:36 Oct 21, 2002 Maveric149 deleted "Dave Farrel"
  306. 02:30 Oct 21, 2002 Brion VIBBER deleted "Xu language"
  307. 02:22 Oct 21, 2002 Maveric149 deleted "Talk:Omagh bombing"
  308. 22:16 Oct 20, 2002 Jheijmans deleted "Hygroscopic"
  309. 22:16 Oct 20, 2002 Jheijmans deleted "Andrew Hartzell"
  310. 22:15 Oct 20, 2002 Jheijmans deleted "Rodney Moore"
  311. 22:15 Oct 20, 2002 Jheijmans deleted "Oyster"
  312. 22:14 Oct 20, 2002 Jheijmans deleted "Turbulence"
  313. 22:14 Oct 20, 2002 Jheijmans deleted "Langj�kull"
  314. 22:14 Oct 20, 2002 Jheijmans deleted "Hofsj�kull"
  315. 22:13 Oct 20, 2002 Jheijmans deleted "Vatnaj�kull"
  316. 22:13 Oct 20, 2002 Jheijmans deleted "Absurd"
  317. 22:13 Oct 20, 2002 Jheijmans deleted "Auguste Comte"
  318. 22:13 Oct 20, 2002 Jheijmans deleted "King Bowser Koopa"
  319. 22:13 Oct 20, 2002 Jheijmans deleted "Transylvanian Saxon"
  320. 22:12 Oct 20, 2002 Jheijmans deleted "Mercury-in-glass thermometer"
  321. 22:12 Oct 20, 2002 Jheijmans deleted "Top-down design"
  322. 22:11 Oct 20, 2002 Jheijmans deleted "Kid"
  323. 22:10 Oct 20, 2002 Jheijmans deleted "Nikolay Nikolaevich Semenov"
  324. 14:35 Oct 20, 2002 Tarquin deleted "Spatial tense"
  325. 13:13 Oct 20, 2002 PierreAbbat deleted "Habib Bourguiba"
  326. 13:12 Oct 20, 2002 PierreAbbat deleted "Talk:Laura Welch Bush"
  327. 13:10 Oct 20, 2002 PierreAbbat deleted "Adelbert von Chamisso"
  328. 13:10 Oct 20, 2002 PierreAbbat deleted "Derg"
  329. 07:42 Oct 20, 2002 Maveric149 deleted "Fritz Perls"
  330. 04:32 Oct 20, 2002 Maveric149 deleted "Tantalum/Temp"
  331. 02:32 Oct 20, 2002 The Epopt deleted "List of articles not about philosophy"
  332. 02:30 Oct 20, 2002 The Epopt deleted "Category experiment"
  333. 20:49 Oct 19, 2002 Jheijmans deleted "Carlow"
  334. 20:49 Oct 19, 2002 Jheijmans deleted "Jos� Ferrer"
  335. 20:49 Oct 19, 2002 Jheijmans deleted "Coal/History"
  336. 20:49 Oct 19, 2002 Jheijmans deleted "Turkmenistan/Human rights issues"
  337. 20:48 Oct 19, 2002 Jheijmans deleted "MeaningfulNess"
  338. 20:48 Oct 19, 2002 Jheijmans deleted "Shepherds Bush"
  339. 20:46 Oct 19, 2002 Jheijmans deleted "Italian Communist Party"
  340. 20:46 Oct 19, 2002 Jheijmans deleted "Fundamental dimensions/Comments"
  341. 20:46 Oct 19, 2002 Jheijmans deleted "Monaghan"
  342. 20:46 Oct 19, 2002 Jheijmans deleted "The Hanged Man"
  343. 20:46 Oct 19, 2002 Jheijmans deleted "Go proverb"
  344. 20:45 Oct 19, 2002 Jheijmans deleted "Mike Dill/My ideas on socital change and terrorism"
  345. 20:44 Oct 19, 2002 Jheijmans deleted "Cavan"
  346. 20:44 Oct 19, 2002 Jheijmans deleted "McMahon Act"
  347. 20:43 Oct 19, 2002 Jheijmans deleted "Writ of Certiorari"
  348. 20:43 Oct 19, 2002 Jheijmans deleted "Sanguozhi"
  349. 20:42 Oct 19, 2002 Jheijmans deleted "NAGPRA"
  350. 20:42 Oct 19, 2002 Jheijmans deleted "Ozarks"
  351. 20:42 Oct 19, 2002 Jheijmans deleted "James Barrie"
  352. 20:41 Oct 19, 2002 Jheijmans deleted "Fuller Seminary"
  353. 20:41 Oct 19, 2002 Jheijmans deleted "Erichtheus"
  354. 20:41 Oct 19, 2002 Jheijmans deleted "Human rights abuses"
  355. 20:40 Oct 19, 2002 Jheijmans deleted "C-47 Dakota"
  356. 20:39 Oct 19, 2002 Jheijmans deleted "C-47 Gooney Bird"
  357. 20:11 Oct 19, 2002 Jheijmans deleted "NormanWerner"
  358. 20:08 Oct 19, 2002 Jheijmans deleted "Propaganda/Slogans"
  359. 20:07 Oct 19, 2002 Jheijmans deleted "Reel-to-Reel"
  360. 20:01 Oct 19, 2002 Jheijmans deleted "Microdot"
  361. 20:00 Oct 19, 2002 Jheijmans deleted "CPM-86"
  362. 20:00 Oct 19, 2002 Jheijmans deleted "Talk:Millinery"
  363. 20:00 Oct 19, 2002 Jheijmans deleted "Millinery"
  364. 20:00 Oct 19, 2002 Jheijmans deleted "2205 BC"
  365. 19:59 Oct 19, 2002 Jheijmans deleted "Mikrophunk"
  366. 19:59 Oct 19, 2002 Jheijmans deleted "Gundobad"
  367. 19:59 Oct 19, 2002 Jheijmans deleted "Best-first search"
  368. 19:58 Oct 19, 2002 Jheijmans deleted "Talk:Philip III of Spain"
  369. 19:58 Oct 19, 2002 Jheijmans deleted "Philip III of Spain"
  370. 19:58 Oct 19, 2002 Jheijmans deleted "Ferdinand I, Holy Roman Emperor"
  371. 19:55 Oct 19, 2002 Jheijmans deleted "Jun Fan"
  372. 18:01 Oct 19, 2002 Maveric149 deleted "Siemens Nixdorf Informationssysteme AG"
  373. 17:38 Oct 19, 2002 Maveric149 deleted "Liaotung Peninsula"
  374. 16:29 Oct 19, 2002 PierreAbbat deleted "Image:Test.phtml"
  375. 16:25 Oct 19, 2002 PierreAbbat deleted "Image:Test.php"
  376. 16:17 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1edit.txt"
  377. 16:15 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1.txt"
  378. 13:35 Oct 19, 2002 Koyaanis Qatsi deleted "Image:Djmangoo-themelody.ogg"
  379. 13:34 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile1.gif"
  380. 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif"
  381. 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif"
  382. 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1.txt"
  383. 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1edit.txt"
  384. 09:52 Oct 19, 2002 Karen Johnson deleted "Bobby Bonds"
  385. 09:49 Oct 19, 2002 Karen Johnson deleted "Euramerica"
  386. 09:48 Oct 19, 2002 Karen Johnson deleted "Hermeneutic"
  387. 09:13 Oct 19, 2002 Karen Johnson deleted "Microsoft SQL server"
  388. 08:54 Oct 19, 2002 Karen Johnson deleted "Maynard James Keenan"
  389. 08:27 Oct 19, 2002 Karen Johnson deleted "Macuxi"
  390. 08:25 Oct 19, 2002 Karen Johnson deleted "Padborg"
  391. 04:48 Oct 19, 2002 Koyaanis Qatsi deleted "Two Women"
  392. 04:46 Oct 19, 2002 Koyaanis Qatsi deleted "A page that will never be written unless some jerk writes it"
  393. 01:34 Oct 19, 2002 Maveric149 deleted "Hernan Cortes"
  394. 01:19 Oct 19, 2002 PierreAbbat deleted "Parse tree"
  395. 23:30 Oct 18, 2002 PierreAbbat deleted "Newbie"
  396. 22:19 Oct 18, 2002 Maveric149 deleted "Canadian Alliance"
  397. 22:05 Oct 18, 2002 Maveric149 deleted "Thirteen Years' War"
  398. 21:18 Oct 18, 2002 Ed Poor deleted "Univeristy of California, Berkeley"
  399. 20:46 Oct 18, 2002 Lee Daniel Crocker deleted "Max Stirner"
  400. 18:52 Oct 18, 2002 Maveric149 deleted "Hawker Hunter"
  401. 11:34 Oct 18, 2002 Karen Johnson deleted "Lindau"
  402. 11:33 Oct 18, 2002 Karen Johnson deleted "Ruma"
  403. 11:32 Oct 18, 2002 Karen Johnson deleted "KDD"
  404. 11:31 Oct 18, 2002 Karen Johnson deleted "Law of conservation of matter"
  405. 10:38 Oct 18, 2002 PierreAbbat deleted "Asymmetric cryptography"
  406. 03:43 Oct 18, 2002 PierreAbbat deleted "Battle of Eylau"
  407. 00:03 Oct 18, 2002 PierreAbbat deleted "My"
  408. 23:03 Oct 17, 2002 Andre Engels deleted "Chilomonas"
  409. 22:30 Oct 17, 2002 PierreAbbat deleted "2208"
  410. 22:28 Oct 17, 2002 PierreAbbat deleted "Water wheel"
  411. 22:25 Oct 17, 2002 PierreAbbat deleted "ASF"
  412. 18:23 Oct 17, 2002 Maveric149 deleted "Goedel's completeness theorem"
  413. 13:51 Oct 17, 2002 Andre Engels deleted "Soon"
  414. 12:34 Oct 17, 2002 Andre Engels deleted "First Crusade"
  415. 12:00 Oct 17, 2002 Stephen Gilbert deleted "Wardian case"
  416. 01:51 Oct 17, 2002 PierreAbbat deleted "Christian Dior"
  417. 01:49 Oct 17, 2002 PierreAbbat deleted "Hybrid monolithic kernel"
  418. 01:15 Oct 17, 2002 Stephen Gilbert deleted "Turn-based game"
  419. 01:15 Oct 17, 2002 Stephen Gilbert deleted "Alain Mimoun"
  420. 22:09 Oct 16, 2002 PierreAbbat deleted "Screen Actors Guild"
  421. 22:08 Oct 16, 2002 PierreAbbat deleted "Middle-Earth Roleplaying System"
  422. 19:46 Oct 16, 2002 Tarquin deleted "Conspicuous consumption"
  423. 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology"
  424. 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology"
  425. 15:52 Oct 16, 2002 Andre Engels deleted "Scientific mythology"
  426. 15:48 Oct 16, 2002 Tarquin deleted "Blue Nile"
  427. 15:33 Oct 16, 2002 Andre Engels deleted "Talk:Hayden Christiansen"
  428. 15:27 Oct 16, 2002 Andre Engels deleted "Talk:Millions of worthless articles"
  429. 15:22 Oct 16, 2002 Andre Engels deleted "Talk:Friends United Meeting"
  430. 15:10 Oct 16, 2002 Andre Engels deleted "Talk:Q Codes"
  431. 11:53 Oct 16, 2002 PierreAbbat deleted "Thivai"
  432. 11:40 Oct 16, 2002 PierreAbbat deleted "Travels With Charley"
  433. 11:38 Oct 16, 2002 PierreAbbat deleted "Problem domain"
  434. 11:22 Oct 16, 2002 Andre Engels deleted "John Forbes Nash"
  435. 10:43 Oct 16, 2002 Jheijmans deleted "The Oresteia"
  436. 10:43 Oct 16, 2002 Jheijmans deleted "Business management"
  437. 10:42 Oct 16, 2002 Jheijmans deleted "Ray Gillen"
  438. 09:35 Oct 16, 2002 Andre Engels deleted "Image:German flag 1815.png"
  439. 09:33 Oct 16, 2002 Andre Engels deleted "Xenon/Temp"
  440. 08:09 Oct 16, 2002 Sjc deleted "Amatol"
  441. 06:47 Oct 16, 2002 Jheijmans deleted "Akron, Ohio"
  442. 06:47 Oct 16, 2002 Jheijmans deleted "Penal code"
  443. 06:47 Oct 16, 2002 Jheijmans deleted "Superstring"
  444. 06:47 Oct 16, 2002 Jheijmans deleted "Unified field theory"
  445. 06:46 Oct 16, 2002 Jheijmans deleted "Other LZ compression methods"
  446. 06:46 Oct 16, 2002 Jheijmans deleted "Bizarro"
  447. 06:46 Oct 16, 2002 Jheijmans deleted "Ear piercing"
  448. 05:59 Oct 16, 2002 Sjc deleted "Flying Wedge"
  449. 05:57 Oct 16, 2002 Sjc deleted "AEW"
  450. 02:47 Oct 16, 2002 PierreAbbat deleted "Homeric Hymns"
  451. 02:46 Oct 16, 2002 PierreAbbat deleted "Pisistratos"
  452. 01:19 Oct 16, 2002 Maveric149 deleted "Sweet Home Alabama (movie)"
  453. 01:05 Oct 16, 2002 Maveric149 deleted "USS Valley"
  454. 00:14 Oct 16, 2002 PierreAbbat deleted "Jay Warren"
  455. 00:12 Oct 16, 2002 PierreAbbat deleted "Mustique"
  456. 22:56 Oct 15, 2002 Maveric149 deleted "Egg cell"
  457. 22:53 Oct 15, 2002 Jheijmans deleted "Ciutat Vella"
  458. 22:49 Oct 15, 2002 Jheijmans deleted "Like nailing jelly to a tree"
  459. 22:48 Oct 15, 2002 Jheijmans deleted "Like kicking dead whales down the beach"
  460. 22:16 Oct 15, 2002 Jheijmans deleted "James Batcheller Sumner"
  461. 22:16 Oct 15, 2002 Jheijmans deleted "MC Det"
  462. 22:06 Oct 15, 2002 Jheijmans deleted "New England boiled dinner"
  463. 22:06 Oct 15, 2002 Jheijmans deleted "1208 BC"
  464. 22:06 Oct 15, 2002 Jheijmans deleted "WikiProject Biology"
  465. 22:05 Oct 15, 2002 Jheijmans deleted "Abelian variety"
  466. 22:05 Oct 15, 2002 Jheijmans deleted "Cassette"
  467. 22:04 Oct 15, 2002 Jheijmans deleted "DBA"
  468. 22:04 Oct 15, 2002 Jheijmans deleted "Application layer"
  469. 22:04 Oct 15, 2002 Jheijmans deleted "Vacation"
  470. 22:04 Oct 15, 2002 Jheijmans deleted "Caledonia"
  471. 22:03 Oct 15, 2002 Jheijmans deleted "Lamp"
  472. 22:03 Oct 15, 2002 Jheijmans deleted "Talk:Status"
  473. 22:03 Oct 15, 2002 Jheijmans deleted "Status"
  474. 22:02 Oct 15, 2002 Jheijmans deleted "Mathematics Magazine"
  475. 22:02 Oct 15, 2002 Jheijmans deleted "Rangefinder cameras"
  476. 22:02 Oct 15, 2002 Jheijmans deleted "Copy protection"
  477. 22:02 Oct 15, 2002 Jheijmans deleted "Other LZ compression methods"
  478. 22:01 Oct 15, 2002 Maveric149 deleted "Laccolith"
  479. 19:37 Oct 15, 2002 Brion VIBBER deleted "Microsoft Windows 2.0"
  480. 18:59 Oct 15, 2002 Stephen Gilbert deleted "Talk:Put"
  481. 18:58 Oct 15, 2002 Stephen Gilbert deleted "SPIHT"
  482. 18:57 Oct 15, 2002 Stephen Gilbert deleted "Put"
  483. 18:57 Oct 15, 2002 Stephen Gilbert deleted "Marcel Petiot"
  484. 18:57 Oct 15, 2002 Stephen Gilbert deleted "WSDL"
  485. 18:28 Oct 15, 2002 Magnus Manske deleted "L�ndervorwahlen/nachNummern"
  486. 18:26 Oct 15, 2002 Tarquin deleted "User:ZxAnPhOrIaN/StateReportSites"
  487. 18:00 Oct 15, 2002 Scipius deleted "Jean Renoir"
  488. 14:48 Oct 15, 2002 Tarquin deleted "Cretinous"
  489. 14:44 Oct 15, 2002 Tarquin deleted "Brain-damaged"
  490. 13:10 Oct 15, 2002 Tarquin deleted "Calculus/chain rule"
  491. 12:29 Oct 15, 2002 Tarquin deleted "Prime number/Talk"
  492. 10:16 Oct 15, 2002 Jheijmans deleted "Slovenia/Temp"
  493. 06:42 Oct 15, 2002 Jheijmans deleted "USS Lake"
  494. 06:41 Oct 15, 2002 Jheijmans deleted "USS Philippine"
  495. 06:41 Oct 15, 2002 Jheijmans deleted "USS Bunker"
  496. 06:40 Oct 15, 2002 Jheijmans deleted "USS San"
  497. 06:40 Oct 15, 2002 Jheijmans deleted "USS Leyte"
  498. 06:40 Oct 15, 2002 Jheijmans deleted "USS Coral"
  499. 06:40 Oct 15, 2002 Jheijmans deleted "USS Belleau"
  500. 06:09 Oct 15, 2002 Karen Johnson deleted "USS Franklin"
  501. 02:02 Oct 15, 2002 Karen Johnson deleted "Brown Deer, Wisconsin"
  502. 02:01 Oct 15, 2002 Karen Johnson deleted "4004 BC"
  503. 02:01 Oct 15, 2002 Karen Johnson deleted "Jacques Cossette-Trudel"
  504. 02:00 Oct 15, 2002 Karen Johnson deleted "University of Wisconsin, Stout"
  505. 01:59 Oct 15, 2002 Karen Johnson deleted "Jangyn Bridge"
  506. 01:59 Oct 15, 2002 Karen Johnson deleted "Poissy"
  507. 01:59 Oct 15, 2002 Karen Johnson deleted "Talk:Poissy"
  508. 01:58 Oct 15, 2002 Karen Johnson deleted "Xerox 1108"
  509. 01:57 Oct 15, 2002 Karen Johnson deleted "Data vector"
  510. 01:55 Oct 15, 2002 Karen Johnson deleted "Danville, Kentucky"
  511. 22:15 Oct 14, 2002 Jheijmans deleted "Bosnian language"
  512. 21:57 Oct 14, 2002 Scipius deleted "Electric battery"
  513. 21:44 Oct 14, 2002 Scipius deleted "Talk:Germany/Temp"
  514. 21:43 Oct 14, 2002 Scipius deleted "Germany/Temp"
  515. 21:13 Oct 14, 2002 Jheijmans deleted "Erasmus"
  516. 21:00 Oct 14, 2002 PierreAbbat deleted "General Federation of Jewish Labour"
  517. 16:35 Oct 14, 2002 Jheijmans deleted "Liudolf of Swabia"
  518. 16:33 Oct 14, 2002 Jheijmans deleted "Quay"
  519. 16:30 Oct 14, 2002 Jheijmans deleted "Emma Bunton"
  520. 16:30 Oct 14, 2002 Jheijmans deleted "Pavel Chekov"
  521. 12:26 Oct 14, 2002 Brion VIBBER deleted "TWA 847 hijacking"
  522. 11:58 Oct 14, 2002 PierreAbbat deleted "U.S. presidential election, 2012"
  523. 09:31 Oct 14, 2002 Maveric149 deleted "Route inspection problem"
  524. 08:55 Oct 14, 2002 Maveric149 deleted "Popper"
  525. 07:56 Oct 14, 2002 Magnus Manske deleted "Henk Rogers"
  526. 07:49 Oct 14, 2002 Jheijmans deleted "Ani Yuntikwalaski"
  527. 07:48 Oct 14, 2002 Jheijmans deleted "Zulch, Evan"
  528. 07:48 Oct 14, 2002 Jheijmans deleted "Evan Zulch"
  529. 07:46 Oct 14, 2002 Jheijmans deleted "Sandra Dempsey"
  530. 07:45 Oct 14, 2002 Jheijmans deleted "Cassiodorus"
  531. 07:45 Oct 14, 2002 Jheijmans deleted "Daniel Vettori"
  532. 07:44 Oct 14, 2002 Jheijmans deleted "El Lissitzky"
  533. 07:44 Oct 14, 2002 Jheijmans deleted "Text to speech"
  534. 07:44 Oct 14, 2002 Jheijmans deleted "Natural language generation"
  535. 07:44 Oct 14, 2002 Jheijmans deleted "Program transformation"
  536. 06:27 Oct 14, 2002 Sjc deleted "Maclyn McCarty"
  537. 04:24 Oct 14, 2002 Maveric149 deleted "2109"
  538. 03:37 Oct 14, 2002 Maveric149 deleted "Phosphorus/Temp"
  539. 01:03 Oct 14, 2002 Maveric149 deleted "Law of Octaves"
  540. 00:56 Oct 14, 2002 Maveric149 deleted "Andr� Malraux"
  541. 22:53 Oct 13, 2002 PierreAbbat deleted "Rockefeller Institute"
  542. 22:52 Oct 13, 2002 PierreAbbat deleted "Acrostic puzzle"
  543. 22:50 Oct 13, 2002 Tarquin deleted "Raymon Smullyan"
  544. 21:19 Oct 13, 2002 Bryan Derksen deleted "Great Red Spot"
  545. 21:14 Oct 13, 2002 Maveric149 deleted "Superscript"
  546. 21:13 Oct 13, 2002 Maveric149 deleted "Natural order"
  547. 21:08 Oct 13, 2002 Andre Engels deleted "Talk:Confused Deputy Problem"
  548. 21:01 Oct 13, 2002 Andre Engels deleted "Talk:Common Earth Language"
  549. 20:58 Oct 13, 2002 Andre Engels deleted "Xerox Document Company"
  550. 20:58 Oct 13, 2002 Andre Engels deleted "Nuclear pile"
  551. 17:31 Oct 13, 2002 PierreAbbat deleted "Cheddite"
  552. 12:25 Oct 13, 2002 PierreAbbat deleted "Supercharger"
  553. 10:32 Oct 13, 2002 Sjc deleted "Holt, England"
  554. 10:24 Oct 13, 2002 Jheijmans deleted "Loaded terminology"
  555. 09:49 Oct 13, 2002 Scipius deleted "Quercus robur- Ongoing projects & To Do list..."
  556. 07:46 Oct 13, 2002 Sjc deleted "October 12 2002 car bomb, Kuta, Bali"
  557. 07:04 Oct 13, 2002 Maveric149 deleted "Latin phrases"
  558. 02:14 Oct 13, 2002 Maveric149 deleted "American Christian Zionists"
  559. 23:34 Oct 12, 2002 Scipius deleted "Curly Howard"
  560. 22:20 Oct 12, 2002 Jheijmans deleted "Steamboat"
  561. 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page A"
  562. 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page C"
  563. 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page B"
  564. 21:12 Oct 12, 2002 Tarquin deleted "Talk:The simpsons/dr. nick riviera"
  565. 20:37 Oct 12, 2002 Jheijmans deleted "Kent Keith"
  566. 20:35 Oct 12, 2002 Jheijmans deleted "FrameMaker"
  567. 16:35 Oct 12, 2002 Andre Engels deleted "Robert Guiscard"
  568. 15:59 Oct 12, 2002 Andre Engels deleted "SoHo, New York City, New York"
  569. 15:59 Oct 12, 2002 Andre Engels deleted "Murray Hill, New York City, New York"
  570. 15:58 Oct 12, 2002 Andre Engels deleted "Harlem, New York City, New York"
  571. 15:58 Oct 12, 2002 Andre Engels deleted "Greenwich Village, New York City, New York"
  572. 15:32 Oct 12, 2002 PierreAbbat deleted "List of famous people who had sex with animals"
  573. 14:36 Oct 12, 2002 Tarquin deleted "ZxAnPhOrIaN/StateReportSites"
  574. 13:09 Oct 12, 2002 PierreAbbat deleted "Charles Cunningham Boycott"
  575. 12:10 Oct 12, 2002 Andre Engels deleted "Internet gaming"
  576. 12:09 Oct 12, 2002 Andre Engels deleted "Joe Rock"
  577. 12:08 Oct 12, 2002 Andre Engels deleted "Herman Brusselmans"
  578. 12:08 Oct 12, 2002 Andre Engels deleted "Queen Anne's War"
  579. 11:49 Oct 12, 2002 Karen Johnson deleted "Europrix"
  580. 03:36 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (city names)"
  581. 03:35 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (ships)"
  582. 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (movies)"
  583. 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (names and titles)"
  584. 03:33 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (precision)"
  585. 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (common names)"
  586. 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (anglicization)"
  587. 03:31 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (pluralization)"
  588. 03:30 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (capitalization)"
  589. 03:28 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (acronyms)"
  590. 02:25 Oct 12, 2002 Karen Johnson deleted "VMWare"
  591. 02:24 Oct 12, 2002 Karen Johnson deleted "List of famous people who had sex with animals"
  592. 00:27 Oct 12, 2002 Tarquin deleted "HfTupper"
  593. 23:47 Oct 11, 2002 Andre Engels deleted "List of collective nouns by collective terms"
  594. 23:44 Oct 11, 2002 Andre Engels deleted "Talk:ColdWar"
  595. 23:03 Oct 11, 2002 Andre Engels deleted "Talk:Chinese characteristics"
  596. 22:58 Oct 11, 2002 Andre Engels deleted "Talk:Queen (Chess)"
  597. 22:49 Oct 11, 2002 Andre Engels deleted "Talk:Ǭ��解"
  598. 22:38 Oct 11, 2002 Andre Engels deleted "Talk:Candy blunt"
  599. 22:33 Oct 11, 2002 Andre Engels deleted "Talk:Business and Industry basic topics"
  600. 22:28 Oct 11, 2002 Andre Engels deleted "Talk:Bubi"
  601. 22:26 Oct 11, 2002 Scipius deleted "Mossel Bay"
  602. 22:25 Oct 11, 2002 Scipius deleted "Georges Pompidou"
  603. 22:24 Oct 11, 2002 Scipius deleted "Carboxyl group"
  604. 22:20 Oct 11, 2002 Andre Engels deleted "Talk:Bridge game"
  605. 22:17 Oct 11, 2002 Andre Engels deleted "Talk:Boure"
  606. 22:16 Oct 11, 2002 Andre Engels deleted "Talk:Boris the crazy Russian"
  607. 22:08 Oct 11, 2002 Andre Engels deleted "Talk:Blue-green money"
  608. 22:00 Oct 11, 2002 Andre Engels deleted "Talk:Bilbo"
  609. 21:49 Oct 11, 2002 Andre Engels deleted "Talk:Belief in God spectrum"
  610. 21:41 Oct 11, 2002 Andre Engels deleted "Talk:Battle of TannenburgBattle of Grunwald"
  611. 21:34 Oct 11, 2002 Andre Engels deleted "Talk:Baptism of the dead"
  612. 21:33 Oct 11, 2002 Andre Engels deleted "Talk:Bantu languages"
  613. 21:30 Oct 11, 2002 Andre Engels deleted "Talk:Baker Natalie Bachrach"
  614. 18:29 Oct 11, 2002 Ed Poor deleted "Talk:List of famous people who have pierced their private parts"
  615. 17:50 Oct 11, 2002 Jheijmans deleted "Victoria, Seychelles"
  616. 11:54 Oct 11, 2002 Andre Engels deleted "Nika revolt"
  617. 11:50 Oct 11, 2002 PierreAbbat deleted "Togidubnus"
  618. 11:15 Oct 11, 2002 Karen Johnson deleted "Antonella Brugnola"
  619. 07:21 Oct 11, 2002 Jheijmans deleted "Siobhan Fahey"
  620. 07:21 Oct 11, 2002 Jheijmans deleted "Augusta of Saxe-Gotha"
  621. 07:20 Oct 11, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction"
  622. 07:19 Oct 11, 2002 Jheijmans deleted "War of the Grand Alliance"
  623. 07:19 Oct 11, 2002 Jheijmans deleted "William Pitt, the Younger"
  624. 06:50 Oct 11, 2002 Jheijmans deleted "Partido dos Trabalhadores"
  625. 06:49 Oct 11, 2002 Jheijmans deleted "Amazonia"
  626. 06:49 Oct 11, 2002 Jheijmans deleted "Fred Olsen"
  627. 06:48 Oct 11, 2002 Jheijmans deleted "Talk:Autodynamics"
  628. 06:48 Oct 11, 2002 Jheijmans deleted "Autodynamics"
  629. 06:47 Oct 11, 2002 Jheijmans deleted "DNA computer"
  630. 06:46 Oct 11, 2002 Jheijmans deleted "Matthew Lancelot Ryan"
  631. 05:34 Oct 11, 2002 Maveric149 deleted "Eternity"
  632. 01:49 Oct 11, 2002 PierreAbbat deleted "Toba"
  633. 01:44 Oct 11, 2002 PierreAbbat deleted "Blah"
  634. 01:00 Oct 11, 2002 Maveric149 deleted "Macintosh raincoat"
  635. 20:49 Oct 10, 2002 Scipius deleted "Cafe wall illusion"
  636. 20:15 Oct 10, 2002 Tarquin deleted "Line segment"
  637. 20:15 Oct 10, 2002 Tarquin deleted "Pembrokeshire"
  638. 20:15 Oct 10, 2002 Tarquin deleted "Channel coding"
  639. 18:07 Oct 10, 2002 Scipius deleted "Image:Uk flag largeupsidedown.png"
  640. 18:04 Oct 10, 2002 Scipius deleted "Image:Waveflag.gif"
  641. 16:11 Oct 10, 2002 Scipius deleted "Nixon"
  642. 12:19 Oct 10, 2002 Jheijmans deleted "Shooting at the 1936 Summer Olympics"
  643. 12:08 Oct 10, 2002 Karen Johnson deleted "Shar"
  644. 09:28 Oct 10, 2002 Jheijmans deleted "Palette"
  645. 09:27 Oct 10, 2002 Jheijmans deleted "Executive department"
  646. 07:00 Oct 10, 2002 Maveric149 deleted "Helium/Temp"
  647. 06:50 Oct 10, 2002 Robert Merkel deleted "Drexel Shaft"
  648. 06:49 Oct 10, 2002 Robert Merkel deleted "Talk:Drexel Shaft"
  649. 06:46 Oct 10, 2002 Jheijmans deleted "Robert Moses"
  650. 06:46 Oct 10, 2002 Jheijmans deleted "Correspondence course"
  651. 06:44 Oct 10, 2002 Jheijmans deleted "Discordance Axis"
  652. 06:44 Oct 10, 2002 Jheijmans deleted "Frederick, Lord North"
  653. 06:44 Oct 10, 2002 Jheijmans deleted "Social Development"
  654. 06:43 Oct 10, 2002 Jheijmans deleted "Obfuscated PostScript Contest"
  655. 06:43 Oct 10, 2002 Jheijmans deleted "Gungan"
  656. 01:19 Oct 10, 2002 PierreAbbat deleted "Pinworm"
  657. 00:26 Oct 10, 2002 Andre Engels deleted "Zacharias Janssen"
  658. 21:43 Oct 9, 2002 PierreAbbat deleted "Motnitroat"
  659. 20:47 Oct 9, 2002 PierreAbbat deleted "Contract bridge palying technique"
  660. 19:54 Oct 9, 2002 Andre Engels deleted "Talk:50 kroner note"
  661. 19:54 Oct 9, 2002 Andre Engels deleted "Talk:200 kroner note"
  662. 19:48 Oct 9, 2002 Magnus Manske deleted "Topory"
  663. 19:42 Oct 9, 2002 Andre Engels deleted "Talk:ATI"
  664. 19:28 Oct 9, 2002 Ed Poor deleted "Time base"
  665. 19:27 Oct 9, 2002 Ed Poor deleted "Staff system"
  666. 19:27 Oct 9, 2002 Andre Engels deleted "Talk:Anthocyanins"
  667. 19:26 Oct 9, 2002 Andre Engels deleted "Talk:Anomy"
  668. 19:25 Oct 9, 2002 Andre Engels deleted "Talk:Angel/far-fetched belief"
  669. 19:24 Oct 9, 2002 Andre Engels deleted "Talk:Ancient civilization"
  670. 19:22 Oct 9, 2002 Andre Engels deleted "Talk:Anarchy Online"
  671. 19:20 Oct 9, 2002 Andre Engels deleted "Talk:American Union of Men"
  672. 19:18 Oct 9, 2002 Andre Engels deleted "Talk:Amead"
  673. 19:15 Oct 9, 2002 Andre Engels deleted "Talk:A.L.I.C.E"
  674. 18:57 Oct 9, 2002 Andre Engels deleted "Talk:Adek336"
  675. 18:50 Oct 9, 2002 Andre Engels deleted "Talk:2002 State of the Union Address"
  676. 18:49 Oct 9, 2002 Andre Engels deleted "Talk:72 virgins"
  677. 18:43 Oct 9, 2002 Andre Engels deleted "Talk:23nd century"
  678. 18:39 Oct 9, 2002 Andre Engels deleted "Talk:Antiwikipedic"
  679. 18:33 Oct 9, 2002 Andre Engels deleted "Painting techniques"
  680. 18:32 Oct 9, 2002 Andre Engels deleted "Anna Moffo"
  681. 17:49 Oct 9, 2002 Scipius deleted "Afar language"
  682. 17:44 Oct 9, 2002 Scipius deleted "Bayer Company"
  683. 17:39 Oct 9, 2002 Scipius deleted "Ypres"
  684. 17:24 Oct 9, 2002 PierreAbbat deleted "Heian Period"
  685. 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu"
  686. 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu"
  687. 08:09 Oct 9, 2002 Andre Engels deleted "Cleisthenes"
  688. 06:34 Oct 9, 2002 Jheijmans deleted "Mossel Bay"
  689. 06:34 Oct 9, 2002 Jheijmans deleted "Clerks"
  690. 06:34 Oct 9, 2002 Jheijmans deleted "World War II/The Blitz"
  691. 06:33 Oct 9, 2002 Jheijmans deleted "Bridge of Sighs"
  692. 06:32 Oct 9, 2002 Maveric149 deleted "Syntax analysis"
  693. 06:07 Oct 9, 2002 Maveric149 deleted "Neon/Temp"
  694. 00:44 Oct 9, 2002 Maveric149 deleted "Waxhaw, South Carolina"
  695. 22:31 Oct 8, 2002 Lee Daniel Crocker deleted "Natural catastrophe"
  696. 22:30 Oct 8, 2002 Lee Daniel Crocker deleted "Ignatius Donnelly"
  697. 21:37 Oct 8, 2002 Jheijmans deleted "Khamis Mushait"
  698. 21:35 Oct 8, 2002 Jheijmans deleted "Kleene algebra"
  699. 21:35 Oct 8, 2002 Jheijmans deleted "Extranet"
  700. 21:35 Oct 8, 2002 Jheijmans deleted "Young Turks"
  701. 21:35 Oct 8, 2002 Jheijmans deleted "Motorola 68008"
  702. 21:34 Oct 8, 2002 Jheijmans deleted "Milwaukee Deep"
  703. 21:34 Oct 8, 2002 Jheijmans deleted "Polish-Lithuanian Commonwealth"
  704. 19:17 Oct 8, 2002 Tarquin deleted "Clifford E. Berry"
  705. 17:30 Oct 8, 2002 PierreAbbat deleted "Cockermouth"
  706. 15:45 Oct 8, 2002 Tarquin deleted "Hiawatha"
  707. 15:44 Oct 8, 2002 Tarquin deleted "Mazurka"
  708. 10:46 Oct 8, 2002 Jheijmans deleted "Provisional Government"
  709. 10:37 Oct 8, 2002 Andre Engels deleted "Internet humor/Two Cows Talk"
  710. 10:36 Oct 8, 2002 Jheijmans deleted "Romania/Temp"
  711. 10:34 Oct 8, 2002 Andre Engels deleted "Beloit College"
  712. 10:31 Oct 8, 2002 Andre Engels deleted "New York City, New York/Murray Hill"
  713. 10:30 Oct 8, 2002 Andre Engels deleted "New York City, New York/Harlem"
  714. 08:56 Oct 8, 2002 WojPob deleted "Motorola Coldfire"
  715. 08:33 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with W"
  716. 08:32 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with X"
  717. 08:31 Oct 8, 2002 Jheijmans deleted "Sympathomimetic"
  718. 08:28 Oct 8, 2002 Jheijmans deleted "Talk:OsmosisTwo"
  719. 08:28 Oct 8, 2002 Jheijmans deleted "OsmosisTwo"
  720. 08:27 Oct 8, 2002 Jheijmans deleted "Protea"
  721. 08:26 Oct 8, 2002 Jheijmans deleted "Teunis de Wit"
  722. 08:26 Oct 8, 2002 Jheijmans deleted "Talk:John T. Thompson"
  723. 08:26 Oct 8, 2002 Jheijmans deleted "John T. Thompson"
  724. 08:25 Oct 8, 2002 Jheijmans deleted "Talk:Kaspar Schlick"
  725. 08:25 Oct 8, 2002 Jheijmans deleted "Kaspar Schlick"
  726. 07:45 Oct 8, 2002 Maveric149 deleted "Manned space mission"
  727. 06:53 Oct 8, 2002 Jheijmans deleted "Lost Jerusalem"
  728. 06:52 Oct 8, 2002 Jheijmans deleted "Eldridge"
  729. 06:52 Oct 8, 2002 Jheijmans deleted "Neo Jerusalem"
  730. 06:51 Oct 8, 2002 Jheijmans deleted "Aveh"
  731. 06:40 Oct 8, 2002 Maveric149 deleted "Rubber tire"
  732. 06:40 Oct 8, 2002 WojPob deleted "APHMEC"
  733. 06:34 Oct 8, 2002 Jheijmans deleted "Teddy Flack"
  734. 06:33 Oct 8, 2002 Jheijmans deleted "Non-zero-sum games"
  735. 06:32 Oct 8, 2002 Jheijmans deleted "Description"
  736. 06:25 Oct 8, 2002 Jheijmans deleted "Meet in the middle"
  737. 06:25 Oct 8, 2002 Jheijmans deleted "Miniscule"
  738. 06:24 Oct 8, 2002 Jheijmans deleted "Joseph-Marie Jacquard"
  739. 06:23 Oct 8, 2002 Jheijmans deleted "William Bradford"
  740. 06:23 Oct 8, 2002 Jheijmans deleted "Hokkien"
  741. 06:23 Oct 8, 2002 Jheijmans deleted "Fad"
  742. 06:22 Oct 8, 2002 Jheijmans deleted "Dahab, Egypt"
  743. 05:45 Oct 8, 2002 Maveric149 deleted "Argon/Temp"
  744. 03:18 Oct 8, 2002 Maveric149 deleted "Kristin Otto"
  745. 02:18 Oct 8, 2002 Brion VIBBER deleted "Hadrian's Wall"
  746. 01:20 Oct 8, 2002 Maveric149 deleted "Jian"
  747. 01:18 Oct 8, 2002 Maveric149 deleted "Cape Town"
  748. 00:10 Oct 8, 2002 Andre Engels deleted "Berger Roy Al"
  749. 00:08 Oct 8, 2002 Andre Engels deleted "Anarcosocial-communism"
  750. 00:08 Oct 8, 2002 Andre Engels deleted "Loyda Morales"
  751. 00:07 Oct 8, 2002 Andre Engels deleted "Bonneville Apartments"
  752. 23:56 Oct 7, 2002 Maveric149 deleted "London College of Fashion"
  753. 23:44 Oct 7, 2002 Maveric149 deleted "Mustard agent"
  754. 23:42 Oct 7, 2002 Maveric149 deleted "Pacific loon"
  755. 23:08 Oct 7, 2002 Maveric149 deleted "Party congress of the CPSU"
  756. 23:03 Oct 7, 2002 Maveric149 deleted "Law of Canada"
  757. 22:14 Oct 7, 2002 Lee Daniel Crocker deleted "WINE"
  758. 21:34 Oct 7, 2002 Tarquin deleted "Madame Grey"
  759. 17:51 Oct 7, 2002 Jheijmans deleted "Luxembourg/Temp"
  760. 15:04 Oct 7, 2002 PierreAbbat deleted "S�Archittu"
  761. 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons (temp)"
  762. 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons"
  763. 14:10 Oct 7, 2002 Jheijmans deleted "Nagoya"
  764. 13:38 Oct 7, 2002 PierreAbbat deleted "S�Archittu"
  765. 13:27 Oct 7, 2002 Jheijmans deleted "Talk:North Brabant/Temp"
  766. 13:27 Oct 7, 2002 Jheijmans deleted "North Brabant/Temp"
  767. 13:24 Oct 7, 2002 WojPob deleted "Defence Intelligence Agency"
  768. 11:06 Oct 7, 2002 Tarquin deleted "Mole (espianoge)"
  769. 10:33 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg"
  770. 10:32 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png"
  771. 10:29 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg"
  772. 10:27 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png"
  773. 07:57 Oct 7, 2002 Isis deleted "Beverly K Effinger"
  774. 07:54 Oct 7, 2002 Jheijmans deleted "Guido Carli"
  775. 06:59 Oct 7, 2002 Jheijmans deleted "Djibouti/Temp"
  776. 06:57 Oct 7, 2002 Maveric149 deleted "Zebulun Kurth-Nelson"
  777. 06:53 Oct 7, 2002 Maveric149 deleted "Clark Prensoil Potter"
  778. 06:52 Oct 7, 2002 Maveric149 deleted "Spoken game"
  779. 06:32 Oct 7, 2002 Jheijmans deleted "Airglow"
  780. 06:32 Oct 7, 2002 Jheijmans deleted "Interjection"
  781. 06:31 Oct 7, 2002 Jheijmans deleted "Babington Conspiracy"
  782. 06:31 Oct 7, 2002 Jheijmans deleted "Executive department"
  783. 06:30 Oct 7, 2002 Jheijmans deleted "Second Athenian Empire"
  784. 06:30 Oct 7, 2002 Jheijmans deleted "Stirrer"
  785. 05:53 Oct 7, 2002 WojPob deleted "Chinese grammar"
  786. 04:26 Oct 7, 2002 Maveric149 deleted "Sexual perversion"
  787. 01:50 Oct 7, 2002 Andre Engels deleted "Walter Benjamin"
  788. 01:48 Oct 7, 2002 Andre Engels deleted "Canandaigua, New York"
  789. 01:45 Oct 7, 2002 Andre Engels deleted "One-party system"
  790. 01:34 Oct 7, 2002 Stephen Gilbert deleted "Logos and slogans"
  791. 23:43 Oct 6, 2002 Maveric149 deleted "Rod Carew"
  792. 23:40 Oct 6, 2002 Maveric149 deleted "Central heating"
  793. 23:36 Oct 6, 2002 Maveric149 deleted "Internet service provider"
  794. 21:50 Oct 6, 2002 Tarquin deleted "National Trust (England, Wales and Northern Ireland) properties"
  795. 21:45 Oct 6, 2002 Tarquin deleted "Parse tree"
  796. 19:56 Oct 6, 2002 Jheijmans deleted "Ellobiopsids"
  797. 19:56 Oct 6, 2002 Jheijmans deleted "Spoken game"
  798. 19:55 Oct 6, 2002 Jheijmans deleted "Olga Pyleva"
  799. 19:55 Oct 6, 2002 Jheijmans deleted "New Ipswich, New Hampshire"
  800. 19:55 Oct 6, 2002 Jheijmans deleted "A00 Sokolsky Opening 1.e4 e5"
  801. 11:08 Oct 6, 2002 Maveric149 deleted "Krypton/Temp"
  802. 10:32 Oct 6, 2002 WojPob deleted "Tezpur, Assam"
  803. 10:30 Oct 6, 2002 WojPob deleted "Stephen King/Dolans Cadillac"
  804. 07:36 Oct 6, 2002 Koyaanis Qatsi deleted "Not Black supremacy"
  805. 07:17 Oct 6, 2002 Jheijmans deleted "Mythology of demons"
  806. 07:16 Oct 6, 2002 Jheijmans deleted "Babington Conspiracy"
  807. 07:15 Oct 6, 2002 Jheijmans deleted "Diplomonads"
  808. 07:15 Oct 6, 2002 Jheijmans deleted "Moose Jaw"
  809. 07:15 Oct 6, 2002 Jheijmans deleted "1 E21 m"
  810. 07:14 Oct 6, 2002 Jheijmans deleted "Florianus"
  811. 21:37 Oct 5, 2002 Brion VIBBER deleted "Junk page that is being deleted to confirm bug is fixed"
  812. 23:15 Oct 5, 2002 WojPob deleted "Mass Production"
  813. 09:51 Oct 5, 2002 Maveric149 deleted "Helsinki"
  814. 14:13 Oct 5, 2002 The Epopt deleted "C-46 Commando"
  815. 14:13 Oct 5, 2002 The Epopt deleted "C-47 Skytrain"
  816. 14:29 Oct 5, 2002 Scipius deleted "Das Kapital"
  817. 06:19 Oct 5, 2002 Maveric149 deleted "Human"
  818. 06:17 Oct 5, 2002 Maveric149 deleted "Humans"
  819. 13:10 Oct 5, 2002 Scipius deleted "Testingwhetherthereisalimittothelengthsofpagenamesddlskdlaskdnvlknancsklnasnfdoaiwnrpiwnrpqnrpqwnrpiqnneifniqnfiqwnipqwnfiqwnfiqwnfpiwqnfpinfipqnfipqwnfipnqwfpniwnfqpmmqcpomowmcmcopqwmpowcmopqwmcoqwpmcowpqmcopqmwcopwmcopmqcwopmcopqmwocpmwocmopcwqmopwqmcop"
  820. 19:26 Oct 4, 2002 Maveric149 deleted "Wikipedia:Tom Tommorrow"
  821. 21:44 Oct 4, 2002 Tarquin deleted "Coppicing/pollarding"
  822. 22:58 Oct 4, 2002 Ed Poor deleted "SPIHT"
  823. 20:35 Oct 4, 2002 Jheijmans deleted "Horace de Saussure"
  824. 20:35 Oct 4, 2002 Jheijmans deleted "Cisternae"
  825. 20:35 Oct 4, 2002 Jheijmans deleted "Israeli Security Zone"
  826. 20:35 Oct 4, 2002 Jheijmans deleted "United Nations Partition Plan"
  827. 17:39 Oct 4, 2002 Koyaanis Qatsi deleted ".phtml"
  828. 18:43 Oct 4, 2002 Ed Poor deleted "State sponsors of terrorism"
  829. 17:43 Oct 4, 2002 Jheijmans deleted "Ghent"
  830. 12:55 Oct 4, 2002 Andre Engels deleted "Pearson Hashing"
  831. 12:37 Oct 4, 2002 Andre Engels deleted "Duck duck goose"
  832. 12:05 Oct 4, 2002 Jheijmans deleted "Exchange rate"
  833. 11:10 Oct 4, 2002 Andre Engels deleted "Red Sonja"
  834. 11:07 Oct 4, 2002 Andre Engels deleted "Johan Helsingius"
  835. 11:01 Oct 4, 2002 Andre Engels deleted "I didn't change anything!"
  836. 08:54 Oct 4, 2002 Jheijmans deleted "Emotional punditry"
  837. 08:54 Oct 4, 2002 Jheijmans deleted "Environmental wacko"
  838. 08:51 Oct 4, 2002 Jheijmans deleted "StarEdit"
  839. 08:49 Oct 4, 2002 Jheijmans deleted "Thames/pollution"
  840. 08:45 Oct 4, 2002 Jheijmans deleted "Ekumen"
  841. 08:44 Oct 4, 2002 Jheijmans deleted "The Dispossessed"
  842. 08:34 Oct 4, 2002 Jheijmans deleted "Vitamin E familial isolated, deficiency of"
  843. 08:34 Oct 4, 2002 Jheijmans deleted "Clara Thrupp"
  844. 08:33 Oct 4, 2002 Jheijmans deleted "Eric Hoffman"
  845. 08:32 Oct 4, 2002 Jheijmans deleted "Talk:Belief"
  846. 08:32 Oct 4, 2002 Jheijmans deleted "Belief"
  847. 08:31 Oct 4, 2002 Jheijmans deleted "Carol"
  848. 08:29 Oct 4, 2002 Jheijmans deleted "Dinant"
  849. 08:29 Oct 4, 2002 Jheijmans deleted "Stevertigo"
  850. 08:29 Oct 4, 2002 Jheijmans deleted "Secret key"
  851. 08:29 Oct 4, 2002 Jheijmans deleted "Dorchester, England"
  852. 08:29 Oct 4, 2002 Jheijmans deleted "G3"
  853. 08:28 Oct 4, 2002 Jheijmans deleted "Philosophical Investigations/family resemblance"
  854. 08:28 Oct 4, 2002 Jheijmans deleted "Aswan High Dam"
  855. 08:28 Oct 4, 2002 Jheijmans deleted "U.s. presidental election, 1948"
  856. 08:27 Oct 4, 2002 Jheijmans deleted "Sunset"
  857. 08:27 Oct 4, 2002 Jheijmans deleted "TWA 847 hijacking"
  858. 06:22 Oct 4, 2002 Brion VIBBER deleted "Green economics"
  859. 08:18 Oct 4, 2002 WojPob deleted "Howdoudeleteapage"
  860. 23:58 Oct 3, 2002 Brion VIBBER deleted "Green Economism"
  861. 19:15 Oct 3, 2002 Jheijmans deleted "Existentialism/Old"
  862. 18:27 Oct 3, 2002 Jheijmans deleted "Toe"
  863. 18:26 Oct 3, 2002 Jheijmans deleted "Electrostatic field"
  864. 18:25 Oct 3, 2002 Jheijmans deleted "Henri D�sir� Landru"
  865. 18:24 Oct 3, 2002 Jheijmans deleted "Marcel Petiot"
  866. 10:27 Oct 3, 2002 Brion VIBBER deleted "Santa Cruz Operation"
  867. 12:16 Oct 3, 2002 Jheijmans deleted "Adzuki bean"
  868. 11:48 Oct 3, 2002 Jheijmans deleted "Obfuscating software"
  869. 10:28 Oct 3, 2002 Tarquin deleted "Hazaed (game)"
  870. 11:19 Oct 3, 2002 Jheijmans deleted "Brazil's anthem, entitled Hino Nacional Brasileiro"
  871. 09:10 Oct 3, 2002 Jheijmans deleted "San Marino/Temp"
  872. 09:01 Oct 3, 2002 Jheijmans deleted "Seth Howard"
  873. 09:01 Oct 3, 2002 Jheijmans deleted "Weak entity"
  874. 09:00 Oct 3, 2002 Jheijmans deleted "Philip III of Spain"
  875. 08:58 Oct 3, 2002 Jheijmans deleted "Charles Spurgeon"
  876. 08:57 Oct 3, 2002 Jheijmans deleted "Hans Eijsackers"
  877. 08:57 Oct 3, 2002 Jheijmans deleted "Morals or Ethics"
  878. 08:56 Oct 3, 2002 Jheijmans deleted "Curved Air"
  879. 08:56 Oct 3, 2002 Jheijmans deleted "Bad Religion"
  880. 08:55 Oct 3, 2002 Jheijmans deleted "Pcl"
  881. 08:55 Oct 3, 2002 Jheijmans deleted "Meersburg"
  882. 08:54 Oct 3, 2002 Jheijmans deleted "Mainau Island"
  883. 08:54 Oct 3, 2002 Jheijmans deleted "Hugh Richardson"
  884. 08:53 Oct 3, 2002 Jheijmans deleted "Andra� Crouch"
  885. 08:53 Oct 3, 2002 Jheijmans deleted "Battle of Lexington and Concord"
  886. 08:52 Oct 3, 2002 Jheijmans deleted "Flight AF 8969 Alger-Paris hijacked"
  887. 08:50 Oct 3, 2002 Jheijmans deleted "University of Kiel"
  888. 08:50 Oct 3, 2002 Jheijmans deleted "Yang di-Pertuan Agong"
  889. 23:48 Oct 2, 2002 Maveric149 deleted "Predicate calculus"
  890. 23:46 Oct 2, 2002 Maveric149 deleted "Radon/Temp"
  891. 19:47 Oct 2, 2002 PierreAbbat deleted "Battle of Lutzen"
  892. 19:45 Oct 2, 2002 PierreAbbat deleted "Talk:Electronic filter"
  893. 19:15 Oct 2, 2002 PierreAbbat deleted "Blue Gene"
  894. 01:43 Oct 3, 2002 Andre Engels deleted "Roman emperor"
  895. 22:00 Oct 2, 2002 Brion VIBBER deleted "Peasants' Revolt"
  896. 23:29 Oct 2, 2002 Andre Engels deleted "Port Royal"
  897. 21:47 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
  898. 21:40 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
  899. 22:43 Oct 2, 2002 -- April deleted "Antiwikipedic"
  900. 22:27 Oct 2, 2002 -- April deleted "Antiwikipedic"
  901. 20:28 Oct 2, 2002 -- April deleted "Antiwikipedic"
  902. 20:24 Oct 2, 2002 -- April deleted "Antiwikipedic"
  903. 20:09 Oct 2, 2002 -- April deleted "Wikipedic"
  904. 20:08 Oct 2, 2002 -- April deleted "Wikipedia: Antiwikipedic"
  905. 20:07 Oct 2, 2002 -- April deleted "Antiwikipedic"
  906. 19:52 Oct 2, 2002 -- April deleted "Antiwikipedic"
  907. 15:54 Oct 2, 2002 Koyaanis Qatsi deleted "Antiwikipedic"
  908. 15:43 Oct 2, 2002 Koyaanis Qatsi deleted "AntiWikipedic"
  909. 00:42 Oct 3, 2002 Stephen Gilbert deleted "Stephen Gilbert"
  910. 00:32 Oct 3, 2002 Stephen Gilbert deleted "STG"
  911. 17:01 Oct 2, 2002 Andre Engels deleted "Laurasia"
  912. 16:52 Oct 2, 2002 Andre Engels deleted "CTSS"
  913. 16:17 Oct 2, 2002 Jheijmans deleted "Maurice"
  914. 14:01 Oct 2, 2002 Andre Engels deleted "Riptor's articles"
  915. 09:20 Oct 2, 2002 Jheijmans deleted "Transaction processing"
  916. 09:08 Oct 2, 2002 Jheijmans deleted "In Vitro Fertilisation/Todo"
  917. 08:50 Oct 2, 2002 Andre Engels deleted "Global warming/Todo"
  918. 08:45 Oct 2, 2002 Jheijmans deleted "Fuller Theological Seminary"
  919. 08:23 Oct 2, 2002 Jheijmans deleted "Pseudorandom"
  920. 08:22 Oct 2, 2002 Jheijmans deleted "Vaux-le-Vicomte"
  921. 08:21 Oct 2, 2002 Jheijmans deleted "Ann Theresa de Keersmaker"
  922. 23:21 Oct 1, 2002 Maveric149 deleted "Barney Rubble"
  923. 23:00 Oct 1, 2002 Maveric149 deleted "Ned Ludd"
  924. 23:00 Oct 1, 2002 Maveric149 deleted "Self-starvation"
  925. 22:57 Oct 1, 2002 Maveric149 deleted "Middle High German"
  926. 22:54 Oct 1, 2002 Maveric149 deleted "Aeolic"
  927. 22:53 Oct 1, 2002 Maveric149 deleted "Oliver Ellsworth"
  928. 22:52 Oct 1, 2002 Maveric149 deleted "HMAS Darwin"
  929. 22:52 Oct 1, 2002 Maveric149 deleted "Chemical burn"
  930. 22:51 Oct 1, 2002 Maveric149 deleted "Fluoride"
  931. 18:57 Oct 1, 2002 Andre Engels deleted "Stem cell/Todo"
  932. 01:06 Oct 2, 2002 Stephen Gilbert deleted "Wikipedia talk:What Google Likes"
  933. 09:57 Oct 1, 2002 Tarquin deleted "Guiness Book of World Records"
  934. 10:39 Oct 1, 2002 Jheijmans deleted "Peat bog"
  935. 09:50 Oct 1, 2002 Jheijmans deleted "Ashtanga Yoga"